KEGG   Leptospira borgpetersenii L550: LBL_0126Help
Entry
LBL_0126          CDS       T00405                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lbl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(147972..148523)
Genome map
AA seq 183 aa AA seqDB search
MEENIVNILKSIGEDPTREGLLNTPKRVKKAYDFLTSGYHVDITKVVNGAIFEESTEGMI
LVRDIEVYSLCEHHLLPFYGRAHVAYLPNKKIIGISKIPRIVDVFARRLQVQERLTEQIA
YAVQEVLDPQGVAVVIKAKHLCMMMRGVEKQNSELFTSCLLGAFKENMVTRSEFLDLIRT
GST
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttggaagaaaatatcgtaaacattctaaaatcgatcggagaagatccgactagagaaggt
cttctcaacactccgaaacgagtgaaaaaagcctacgactttctgacatccggctaccac
gtcgacattacaaaagttgtcaacggagcgatctttgaagaatctacggaaggaatgatc
ctcgttcgagacatcgaagtgtattctctctgtgaacatcatcttcttcctttttacgga
agagctcatgtcgcttatcttcctaataaaaagatcatcggaatcagcaaaattcctcga
atcgtcgatgtgtttgccagaagacttcaagttcaggaacgtctcacggaacaaatcgcc
tacgccgttcaagaagttctcgatccccaaggagtcgcggtggtcattaaggcgaaacat
ctttgtatgatgatgaggggagtcgaaaaacaaaattcggaacttttcacctcctgcctg
ttaggggcttttaaagaaaatatggtaacccgttccgagtttttggatctcattcgcacc
ggatctacttga

DBGET integrated database retrieval system