KEGG   Leptospira borgpetersenii L550: LBL_0145Help
Entry
LBL_0145          CDS       T00405                                 

Gene name
phoD
Definition
phosphodiesterase I
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lbl00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:lbl00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:lbl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(168590..169918)
Genome map
AA seq 442 aa AA seqDB search
MKFRILKHKRVLYYLLLIFNLQLNAEAAKIVSGPILGYSTLKEVLVWIQTDQASKVALEY
SEIGNPRNRYISETIQTDYKTGFIAKLIANRVEPGKSYNYNLLVDGKRIKGEHPQTFQAQ
SFFAYASHQDPPSFSFALGSCAYVNESEFDVPGKPYGGEYFIFNSILSKKPNFMLWLGDN
IYLREPDWDSRTGFLHRYRHQRGIPELAPLFASVHHYAIWDDHDFGPNDSDSSFWMRETS
EEMFKLHWGNPNYAKEGIYGSFVWGDVQFFLLDNRTFRTANNNREIGPRQILGEKQFQWF
VNSLAYSKATFKFVAIGGQFLNPNSVFENHATYPQERNKILSAIRDLKIKNLIFLTGDRH
HTELNFLQEDDISIYDFTVSPLTSRYYSPSEKNPLRVEGTLVDKRNFGTISVSGKRGQRK
LVLQIFDVYGKELWKKEILPTP
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcagaattctaaaacacaaaagagttctttattatcttctattgatttttaat
cttcaactaaatgcagaggcagccaaaattgtctctggaccgattttgggatattccaca
ttaaaggaagttttagtctggattcaaactgatcaggcttccaaagttgcattagaatat
tctgaaattggaaatcctaggaataggtatatttccgaaacaatacaaacggattataaa
acgggctttatcgcaaaattgatcgcaaaccgcgtcgaacctggcaaaagttataattac
aatctactcgtagacggaaaaagaattaaaggggaacacccgcagacatttcaggcacaa
tcattttttgcctatgcgtcccatcaagatccgccttcattctcgttcgcgcttggaagt
tgcgcttatgtcaatgaaagtgaatttgatgtccctggaaaaccttatggcggtgaatac
tttatctttaactctatcctttccaaaaaaccgaattttatgctctggctcggagacaac
atctatctgagggaaccggattgggattcaagaaccggtttcctgcatcgttataggcat
cagcgtggaattccagaacttgctccgctttttgcatcggtccatcactatgcgatttgg
gacgatcatgatttcggtccgaacgactcggattcttccttttggatgagagaaacttcg
gaagaaatgttcaaacttcattggggaaatccgaattatgcaaaagaaggtatctacggc
tctttcgtttggggagacgttcaattttttcttttggataatcgaacatttagaacggca
aataacaaccgggaaatcggcccgagacaaattctgggagaaaaacaatttcagtggttt
gtaaattctttagcatattcaaaagccacatttaagttcgtcgcgatcggcggacaattt
ttaaacccgaactccgtttttgaaaaccacgccacatatcctcaagaaagaaataaaatc
ctttccgcgattcgagatttaaaaattaaaaatctgatttttctcacgggtgatcgccat
catacggagttgaactttcttcaggaagacgacatatcgatttacgatttcaccgtttca
ccattaacttccagatattattccccttctgaaaaaaatcctttacgggtggaaggaacc
cttgttgataaaagaaattttggaacgatttccgtaagcgggaaacgaggtcaaagaaaa
cttgttctacagatttttgacgtatatggaaaagagctttggaaaaaagaaatccttcca
accccttaa

DBGET integrated database retrieval system