KEGG   Leptospira borgpetersenii L550: LBL_0149Help
Entry
LBL_0149          CDS       T00405                                 

Gene name
ilvC
Definition
ketol-acid reductoisomerase (EC:1.1.1.86)
Orthology
K00053  
ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    LBL_0149 (ilvC)
   01230 Biosynthesis of amino acids
    LBL_0149 (ilvC)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    LBL_0149 (ilvC)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LBL_0149 (ilvC)
Enzymes [BR:lbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase
     LBL_0149 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:175773..176774
Genome map
AA seq 333 aa AA seqDB search
MANIYYDADCDLSSLKGKTIAVIGYGSQGHAQAQNMKDSGLKVIIGLKEGSKSIQDAKNA
GFEVYSVAEASQKADVIQILAPDTIQADLYKKDIEPNLKKGNALVFSHGFNIHYDFIKPP
EEVDVYMVAPKGPGHLVRRVYTEGGGVPCLIAVHQDSTGEAKKRALAHAAGVGGGRAGIL
ETSFREETETDLFGEQVVLCGGLSNLIMAGFETLTEAGYDPEIAYFECLHEVKLITDLIY
EGGLARMRFSISDTAEYGDYVSGPRVIDPGVKQRMKEVLNDIQKDKGAKFATNWMAETKA
GYPNFKNMRDKNAAHPIESVGKKLRSMMKWLSK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatatctattacgacgccgattgtgatttaagctctctaaaaggaaaaaccatc
gcagtaatcggttacggaagtcagggacatgctcaggctcaaaatatgaaagattccggg
cttaaagttatcattggtttaaaagaaggatccaaatcaattcaagatgccaagaatgca
ggctttgaagtatacagtgttgccgaagcttctcaaaaagcggatgtcatacaaattctc
gccccggatacgattcaagcggatctttataaaaaagatattgaaccgaatctgaaaaaa
gggaatgcactcgttttttctcacggattcaacattcactacgatttcatcaaacctcct
gaagaggtggatgtttatatggttgctcctaaaggtccgggccatcttgttcgtagagtt
tatacggaaggcgggggagttccatgtttgattgcggttcatcaggattcaactggcgag
gctaaaaaaagggcgcttgctcatgccgccggtgtcggaggcggtcgtgcaggaattttg
gaaacatcttttcgtgaagaaaccgaaacggacttattcggagaacaggttgttctttgc
ggcggtctttccaatctaatcatggccgggtttgaaactttaaccgaagcaggttatgat
cctgaaatcgcgtacttcgagtgtcttcatgaagtgaaactcatcaccgatctcatctac
gaaggcggattggcaagaatgaggttttctatttccgataccgcggaatacggcgattac
gtaagcggcccgcgcgtaattgacccaggtgtaaaacaaagaatgaaagaagttctgaac
gatattcagaaagataagggagcaaaattcgcaaccaactggatggctgaaacgaaagcc
ggttacccaaactttaaaaatatgagagataagaacgcggctcatccgatcgaatcggtt
ggtaaaaaactgagaagtatgatgaagtggttatctaagtaa

DBGET integrated database retrieval system