KEGG   Leptospira borgpetersenii L550: LBL_0185Help
Entry
LBL_0185          CDS       T00405                                 

Definition
oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
lbl  Leptospira borgpetersenii L550
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    LBL_0185
Enzymes [BR:lbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     LBL_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:216416..218155
Genome map
AA seq 579 aa AA seqDB search
MSLDSTLKRKEILYDYDYIIVGSGFGGCVSALRLSQKGYKVAVLESGKRWNSSEFPKTNW
NLRKFLWFPKLFCFGIQRINFLNDVMVLSGAGVGGGSLVYANTLYVPPEPFWKKEIVQKM
GGKKGILPFYELAKKMLGVVENPKTWESDRYMQETAKTFGIENTFNKTPVGVHFGKNGID
PFFGGEGPERNSCNDCGGCMVGCRYNAKNTLDKNYLYFAEKAGAVIFPETKVSKLAPLGE
DGSEGYEVHTEKTTSLFGYPKKIYKVKSVVLSAGVLGTLGLLLKMKEEGILPKLSKQLGQ
VVRTNSESLIGVTLKDKKADLSHGIAITSSVFPDEHTHIEPVRYSDGADAMNSLAAGVLV
DGGGSIPRQLRFLIEVLKHPIHSVSLLNPIGFARRTIILLVMQTVDNSIEIVRKRRWIWP
FKRTLSSTQESGEKIPTYIPIANEFAKRLAKISGGIARSSINEALLDIPATAHILGGCNI
GESSETGVIDLQNKVYGYQNLRICDGSMIPANLGVNPSLTITALTERAMSFVAPKEKEIF
NFKFEKKWGVIGLFGKVKNAAITTGARKNKPTPRAKNKR
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagattcgaccttaaaaaggaaagaaattctttatgactacgattatatcata
gtcggctcaggttttggaggatgtgtctccgcacttcggctttcgcaaaagggatataag
gtggctgttttagaatcagggaaacgatggaacagttccgaattccccaaaactaattgg
aatttacgcaagtttctttggtttccgaaacttttttgttttggaattcaaagaatcaac
tttctaaacgacgtaatggttttgagtggtgcgggagtgggaggcggaagtcttgtttat
gcgaatacgttgtatgttcctcccgagccattttggaaaaaggaaatcgtccaaaaaatg
ggaggaaaaaaagggatccttcccttctacgaacttgcgaagaaaatgttaggcgtcgtg
gaaaatccgaagacttgggaatcggatcggtatatgcaggaaactgcaaaaactttcgga
attgaaaacacatttaacaaaactccggtaggagttcacttcggtaaaaacggcatcgat
ccttttttcggaggagaagggccggagagaaattcctgcaacgattgcggcggttgtatg
gtcggttgtcgttataacgcaaagaatacccttgataagaattatctttattttgcggag
aaggcgggagcggttatttttccggaaacaaaagtttccaagctagcgccgttaggcgaa
gacggttcggaaggttatgaagttcataccgagaaaacgacttctttgttcggttatccc
aaaaaaatctataaagtaaaatccgttgttctttccgccggagttttgggaaccttgggt
cttcttttaaagatgaaagaagaaggaattcttcctaaactttccaaacagttaggacaa
gtcgttcgaaccaacagtgagtcgttaatcggagtgacactcaaagacaagaaagcggat
ttatcccacgggattgcaatcacttccagcgtttttccggatgaacatactcacatagag
ccggttcgttattcggacggggcagacgctatgaatagtttagctgcaggggttctcgtg
gacggagggggaagcattccgagacaactgcgatttttgattgaagtgctaaaacatccg
atccatagtgttagcctgttgaaccctatcgggtttgcaagaaggacaatcattctactt
gtaatgcaaactgtggacaatagcatcgagattgttcgtaagagaagatggatctggccg
ttcaagagaaccctttcttccactcaggaaagcggagaaaaaattcctacctatatcccg
attgcaaacgaatttgcgaaaaggctggctaagatttcgggagggatcgcaagaagtagt
atcaacgaggccttgttggatattccggctaccgcacatatattaggagggtgtaatata
ggagagagttccgaaacaggtgtgattgatcttcaaaataaggtttatggctaccagaat
cttaggatttgtgatggttctatgattccagctaatttgggtgtcaatccgagtcttacg
atcacggctcttacggaaagagcgatgtcctttgtggctccgaaagagaaggaaatattt
aactttaaattcgaaaaaaaatggggtgttatcggtcttttcggtaaggtaaaaaacgcc
gcaattacgaccggggcccgtaagaataaaccgaccccaagagcaaaaaacaaaagatag

DBGET integrated database retrieval system