KEGG   Leptospira borgpetersenii L550: LBL_0235Help
Entry
LBL_0235          CDS       T00405                                 

Definition
(GenBank) Strictosidine synthase
  KO
K01757  
strictosidine synthase [EC:4.3.3.2]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
Enzymes [BR:lbl01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.2  strictosidine synthase
     LBL_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1:complement(281877..282956)
Genome map
AA seq 359 aa AA seqDB search
MFKKIFHFFSVLIFLSLFFLGFLFLRSNKSTNQYLSDSPFDPGKNNFLLESEWIHKETLN
QPYGIAIDTSGFVYTGTADYKIVRIRTNEKVETFAILEGRPLGMVFDSNGNLLVCVEEIG
IVEINKSGSQRILISKLPDGSPLRFPHGIDVTKNGKIYFTVSSRSYSFKESFLEELSSKS
DGMILTADKDINSLEILNESLFYPTGIALSSNEQFLLVSEPFRHRISSIPLSGQKKGVEK
FFLTNIPGLPALITGNSGSFWIGVPYFRNEVLDKIQEYPGIKNLLTGLPNFLFARNTPRG
LIFGLNDFGDITANYQDFSGSSVTGITAILKHAGNIYLVSSTTGKIAKMKPIIEEIQFF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaatttttcactttttttcagtactgatatttctttctctattcttcttg
ggttttttatttttacgttcgaataaaagtaccaaccaatatctttccgattctcccttt
gatcccggaaaaaataattttctcttggaatcggagtggatccataaggaaactttaaac
caaccttacggaattgcaattgatacctccggttttgtttataccgggaccgcagattac
aaaattgtacgaatccgtaccaatgaaaaggtagaaacatttgcgatcctcgagggaagg
ccgttgggaatggtttttgactcaaatggaaatctcttggtttgtgtggaagaaatcgga
attgtagagatcaataaaagcggttctcaaagaattctgatttctaaacttccggacggt
tccccgcttcgatttccacacggaatcgatgtgactaaaaacgggaaaatttatttcacc
gtttccagtcgatcttactctttcaaagaatcatttttagaggagctctcctccaaatca
gatggaatgattttaacggcggataaagatattaattcattagaaattttgaatgaaagt
ctgttttatcccacggggatcgcgttatcatccaacgaacaatttttactcgtatcggaa
ccgtttcgtcacaggatttcttctatcccattgtcgggccaaaaaaaaggtgtggaaaaa
ttttttctcacgaacatcccgggacttccggctttgattaccggaaactccggttctttt
tggattggagttccttattttagaaacgaggttttggataagattcaggagtatcccgga
attaaaaatttactgacgggcctacccaattttctttttgctagaaacacacccagaggt
ttgatattcgggttaaacgatttcggagatattacggccaattatcaggatttttcgggt
tcttccgttacgggaattacggcgattttaaaacacgcgggaaatatctatctcgtttct
tcgaccaccggtaaaatcgcaaaaatgaaaccgataatcgaagaaattcaatttttctaa

DBGET integrated database retrieval system