KEGG   Leptospira borgpetersenii L550: LBL_0403Help
Entry
LBL_0403          CDS       T00405                                 

Definition
L-isoaspartate protein carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lbl  Leptospira borgpetersenii L550
Brite
Enzymes [BR:lbl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LBL_0403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(473947..474612)
Genome map
AA seq 221 aa AA seqDB search
MSFSSKICNPILREKERKNMVDFQIVSRGIRNKKVLSAMRSIPRECFVPDSHVSQAYDDK
PLPIGYHQTISQPFMVAWMSLLLEIRKGDRIFEIGTGSGYQSAVLIFLGAKLFSVEFFES
LHKIAIQNLELWNPGCTRTNRFVSGNATQVLKPELQFDKMISCAALPDLPGVESSYFHSL
VPGGFFIFPMGKKKQFLITARRNWNDWSFESKCEVKFVPLL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttcatctaagatttgtaatccgattcttcgtgaaaaagagagaaagaatatg
gtcgatttccaaatcgtttctcgaggaattcgtaataaaaaagttctctctgcgatgcgt
tcgattccaagagaatgttttgtacctgattcccacgtttcgcaagcgtatgacgacaaa
cctttaccgatcggatatcatcaaacgatttcacaaccgttcatggtcgcatggatgtct
ctgcttcttgaaattcgaaagggcgatcgaattttcgaaatcggtaccggctccggttat
caaagcgccgttttaatttttcttggagcgaagttattctccgttgagttctttgaatct
cttcataaaatcgcgattcaaaatttagaactctggaatccgggttgtactcgaacaaac
cgttttgttagcggaaatgcaactcaagttctcaaacctgaacttcaatttgataagatg
atttcctgcgccgctcttcccgatcttcccggcgtggaaagttcctactttcactccctg
gtcccgggaggtttttttatttttcctatgggaaagaaaaaacaatttttaataaccgca
agaaggaattggaacgattggtcttttgaatctaagtgtgaagtgaaattcgttccctta
ctttaa

DBGET integrated database retrieval system