KEGG   Leptospira borgpetersenii L550: LBL_0563Help
Entry
LBL_0563          CDS       T00405                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBL_0563 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBL_0563 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LBL_0563 (thrC)
Enzymes [BR:lbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LBL_0563 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:623626..624969
Genome map
AA seq 447 aa AA seqDB search
MISTLTRYKAEFECINDSCKTRYDLNEIVYECKKCGSLLQVSHDLEALRTVSGKEWKDRF
DSRFRSVKFPNSSGIWNKREWVLPHIEDKNIVTSGEGLTHLFTSDRLTESLGLGNFYVKQ
CGISHTGSFKDLGMTVLLSQVKHMITSGVPIHAVACASSGDTSAALASYAAKAGIPAIIF
LPAGKVSQAQLIQPVSNGAKVIALDTDFDGCMQIVKEVTREAGIYLANSMNSLRIEGQKT
ISVEIVQQLEWKVPDWIVIPGGNLGNVSALGAGFEMMFSLGLVDKLPRIALAQAEHANPL
YLSYLKNFESFEPVVAKTTLASAIQIGNPVSIQKAIKTLKKFNGVVEQANESELANAAAK
ADLFGLYNDPHTGVALATLEKLIQKGTIAKGESVVVISTAHGLKFTEFKLQFHDGKIPQV
DSTVVNSIHRIEPNATKVIDLIRKLLF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgatctccactcttacccggtacaaagcggaatttgaatgtattaacgactcttgcaaa
actcggtacgatctgaacgagatcgtctacgaatgtaaaaaatgcggaagtcttctccaa
gtatcacatgacttggaggcgttgagaaccgtatcgggaaaagagtggaaagatcgattc
gattccagatttcgttccgtaaagtttccgaattcttccggaatttggaataaaagagaa
tgggttcttcctcatatcgaagataagaatatcgtaacctccggggaagggctcactcat
ctttttacttccgatcgattgactgaaagtctcgggctcggaaatttttacgtaaaacaa
tgcgggatttcgcacacgggttcgttcaaagatctcggaatgaccgttttattatcccaa
gtaaaacatatgatcacgtccggcgttccgattcatgcggtggcttgtgcaagttccgga
gatacttccgctgcacttgcgtcttacgcggcaaaggcgggaataccagcgattatattt
ttgcctgcgggaaaggtatcgcaagcgcagttgatccagccggtatcgaacggagccaag
gtaatcgcactcgacacggattttgacggatgtatgcaaattgtcaaagaagtgacgagg
gaagcgggaatttatcttgcaaactcgatgaattctttacggatcgaaggacaaaaaacg
atttccgttgaaattgtgcaacagttggaatggaaggttccggattggatcgtgattccg
ggaggcaatcttggaaacgtatccgcgcttggagctggatttgagatgatgttttctttg
gggcttgtcgataaacttcctaggatcgctttagcccaagcggaacatgcgaatccgtta
tatctttcttacttaaagaattttgaaagtttcgaaccggttgtcgctaagactacgctt
gcgtccgcgattcaaatcggaaatccggtttccatccaaaaggcgattaaaactctcaag
aagttcaatggagtcgtggaacaggctaatgagtcggaattggcgaatgcggcagcaaag
gcggacttattcggtttatacaatgatcctcatacgggagtggctctggcgactttggaa
aagctgatccaaaaaggaacgatcgctaaaggggagagtgtggtcgttatttcgaccgct
cacggattgaagttcaccgaattcaaacttcagttccacgacggaaaaattccgcaagta
gattctacggtcgtgaattccattcatcgaattgaaccgaatgcgacaaaagtcatcgac
ttaatccggaaattgttgttctag

DBGET integrated database retrieval system