KEGG   Leptospira borgpetersenii L550: LBL_0563Help
Entry
LBL_0563          CDS       T00405                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
lbl00260  Glycine, serine and threonine metabolism
lbl00750  Vitamin B6 metabolism
lbl01100  Metabolic pathways
lbl01110  Biosynthesis of secondary metabolites
lbl01120  Microbial metabolism in diverse environments
lbl01230  Biosynthesis of amino acids
Module
lbl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBL_0563 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LBL_0563 (thrC)
Enzymes [BR:lbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LBL_0563 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABJ78154
Position
1:623626..624969
Genome map
AA seq 447 aa AA seqDB search
MISTLTRYKAEFECINDSCKTRYDLNEIVYECKKCGSLLQVSHDLEALRTVSGKEWKDRF
DSRFRSVKFPNSSGIWNKREWVLPHIEDKNIVTSGEGLTHLFTSDRLTESLGLGNFYVKQ
CGISHTGSFKDLGMTVLLSQVKHMITSGVPIHAVACASSGDTSAALASYAAKAGIPAIIF
LPAGKVSQAQLIQPVSNGAKVIALDTDFDGCMQIVKEVTREAGIYLANSMNSLRIEGQKT
ISVEIVQQLEWKVPDWIVIPGGNLGNVSALGAGFEMMFSLGLVDKLPRIALAQAEHANPL
YLSYLKNFESFEPVVAKTTLASAIQIGNPVSIQKAIKTLKKFNGVVEQANESELANAAAK
ADLFGLYNDPHTGVALATLEKLIQKGTIAKGESVVVISTAHGLKFTEFKLQFHDGKIPQV
DSTVVNSIHRIEPNATKVIDLIRKLLF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgatctccactcttacccggtacaaagcggaatttgaatgtattaacgactcttgcaaa
actcggtacgatctgaacgagatcgtctacgaatgtaaaaaatgcggaagtcttctccaa
gtatcacatgacttggaggcgttgagaaccgtatcgggaaaagagtggaaagatcgattc
gattccagatttcgttccgtaaagtttccgaattcttccggaatttggaataaaagagaa
tgggttcttcctcatatcgaagataagaatatcgtaacctccggggaagggctcactcat
ctttttacttccgatcgattgactgaaagtctcgggctcggaaatttttacgtaaaacaa
tgcgggatttcgcacacgggttcgttcaaagatctcggaatgaccgttttattatcccaa
gtaaaacatatgatcacgtccggcgttccgattcatgcggtggcttgtgcaagttccgga
gatacttccgctgcacttgcgtcttacgcggcaaaggcgggaataccagcgattatattt
ttgcctgcgggaaaggtatcgcaagcgcagttgatccagccggtatcgaacggagccaag
gtaatcgcactcgacacggattttgacggatgtatgcaaattgtcaaagaagtgacgagg
gaagcgggaatttatcttgcaaactcgatgaattctttacggatcgaaggacaaaaaacg
atttccgttgaaattgtgcaacagttggaatggaaggttccggattggatcgtgattccg
ggaggcaatcttggaaacgtatccgcgcttggagctggatttgagatgatgttttctttg
gggcttgtcgataaacttcctaggatcgctttagcccaagcggaacatgcgaatccgtta
tatctttcttacttaaagaattttgaaagtttcgaaccggttgtcgctaagactacgctt
gcgtccgcgattcaaatcggaaatccggtttccatccaaaaggcgattaaaactctcaag
aagttcaatggagtcgtggaacaggctaatgagtcggaattggcgaatgcggcagcaaag
gcggacttattcggtttatacaatgatcctcatacgggagtggctctggcgactttggaa
aagctgatccaaaaaggaacgatcgctaaaggggagagtgtggtcgttatttcgaccgct
cacggattgaagttcaccgaattcaaacttcagttccacgacggaaaaattccgcaagta
gattctacggtcgtgaattccattcatcgaattgaaccgaatgcgacaaaagtcatcgac
ttaatccggaaattgttgttctag

DBGET integrated database retrieval system