KEGG   Leptospira borgpetersenii L550: LBL_0731Help
Entry
LBL_0731          CDS       T00405                                 

Gene name
mauG-1
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lbl  Leptospira borgpetersenii L550
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:828317..829363
Genome map
AA seq 348 aa AA seqDB search
MNNVYRGVGLFRILWTVFLIFSLLLICTCKDEKKEAVHKAGETKKVETIAYPFPPDNAPT
PARILLGKTLFFDPILSGSNWISCATCHNPGLAWTDGLKTAVGHNMKILGKNTPTILNGA
YGNKMFWDGRADNLEAQALGPISSPDEMNQKIDELILELKNIRGYRELFSKAYPNEDINA
VTIGKAIASFERTIFSTESAFDLWKKGNKGAISESAQRGFSVFNGKANCSACHQGDQFSD
NGFHNIGLKNASKEVGRFKIVAVKSMKGAFKTPGLRDVALTGPYMHNGSYATLEEVVERY
DRGGDEKNNLDPNMTALKLTKDEKADLVEFMKSLNGKMVPISIPEFPR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaataacgtttataggggggttggtttgtttcgaattctttggaccgtatttttgatt
tttagtttacttttgatatgtacctgcaaagacgaaaagaaagaagccgttcataaagca
ggtgaaacgaaaaaggtcgaaacgatcgcctatcctttccctcccgataatgcgcctact
ccggcaagaatcttattggggaaaactttatttttcgatccgattctttccggctccaat
tggattagttgcgccacttgccataatccgggtctcgcttggacggacgggttaaaaacc
gcagtcggacataatatgaaaattttgggaaaaaatactcccacgattctcaacggagcg
tacggaaacaaaatgttctgggacggcagggcggacaatctggaagcccaagcgttgggt
ccgatttcatctcccgatgaaatgaatcagaaaatagacgagcttatattagaattaaag
aatattcgggggtatagagaattgttttccaaggcgtatccgaacgaggatataaatgcg
gtaacgatcggaaaggcaattgcaagttttgaaagaacgatcttttctacggaatctgcg
tttgatctttggaaaaaagggaataaaggcgccatttcggaatcggcacaaaggggcttt
tccgtctttaacggaaaagccaattgttccgcatgtcatcaaggcgaccaattttcggat
aacggatttcataatataggtttaaaaaatgcctccaaggaagtcggaagatttaaaatc
gtggctgtaaaatccatgaaaggcgcttttaaaaccccgggcttgcgggacgttgctttg
acgggaccgtatatgcacaatggaagttatgctaccttggaagaagtcgttgaacgttat
gatcgaggaggggatgaaaaaaacaatctggatccgaatatgacggctctcaaactgacg
aaggatgaaaaggccgatctcgtcgagtttatgaaatccctaaacggcaaaatggttccg
atttcgattccggagtttccaagataa

DBGET integrated database retrieval system