KEGG   Leptospira borgpetersenii L550: LBL_0825Help
Entry
LBL_0825          CDS       T00405                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LBL_0825
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBL_0825
   00600 Sphingolipid metabolism
    LBL_0825
Enzymes [BR:lbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LBL_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(954344..956284)
Genome map
AA seq 646 aa AA seqDB search
MKAILRYKVYENSFTSSFEISGKGTKTSSDCGNFSLSLGHKKTGKNETFKPYLEWIGEQR
PKAGTEILTLEIELPPHSLAEPKIFQQGYQSWSLSAVHSLSDADESPRLNFLRYSQENFY
TNHSGVGGDWQSEGMILLISSAKDPHYFAGAIGPGEQGVKFRVISSQRKKELENSKKKSW
IPDSGISLIYDFYRYEDFRGNKLSLTPVAVTRFTISPETYLKKYFSELGKTHKVKLPTTS
VPTGWCSWYQYYTKISEKIILKNLALVKEKKLPIQFFQIDDGYQKEIGDWLTTNDRFPGG
MRLLAEEIRREKLTPGIWLAPFLVRKKSEFYQKYPEAILKDRDGKPVPALWNPHWGMDYT
YCVDVTHPTSRDFLENILKTIVKDNGYQYLKLDFLYAALLPGWTYDRNISPHKRYVDTIR
FVRKVVGKDVFLLGCGAPIYPSIGLFDAMRIGCDVAPFWEREKTRILAKDKHALSTERAL
INDITRSSMHRNLWYNDPDCLLVRESKNHMTYAQTQLMASVMAVSGGMIFVSDDLSRVGE
ERLALLKKTLELGVKCRSKTPVPIGFASGSFPSALYNPAGFLGIWNPREEESTIEIQVPF
ISKLKQFPDYWTGKVPESLEYFSRSGVLKLKLPAYGSVVLQTAKVV
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccattttaagatataaagtctatgagaattcctttacatcctcatttgaaatt
tccggcaaaggaaccaaaacttccagcgactgtggaaatttttccctttcccttggtcat
aaaaaaacggggaagaacgaaacattcaaaccgtatctcgaatggatcggagaacaaaga
cccaaagccggaaccgaaattctcaccctggaaatagaacttccaccgcactcgttggca
gaaccgaagatcttccaacaaggttatcaatcctggagtctttccgccgttcactccctt
tccgacgcggatgaatctccgaggttgaatttccttcgatattctcaggagaatttctat
acgaatcattccggtgtcggaggagattggcagagtgaagggatgattcttctgatttct
tccgcaaaggatccgcattattttgcgggagcaattggtcccggagaacaaggagtaaaa
ttcagagtcatttcctctcaaagaaaaaaggaactggagaactccaaaaaaaaatcctgg
attcccgattccggaatttccttgatctacgacttctatcgttacgaggatttcagaggg
aataaactttccctcactcccgtcgcagtaacccgttttaccataagcccggaaacatat
ttaaaaaagtattttagtgaattaggaaaaactcataaagtaaaacttcccacaacatct
gttccgaccggatggtgttcctggtaccaatactacactaaaatttccgaaaagatcatt
ttgaaaaatctcgctcttgtaaaagagaaaaaactcccgattcaattctttcagatcgac
gacggttatcaaaaagagatcggggattggctgaccacgaacgatcggtttcccggagga
atgagacttttagccgaagaaatccgaagggaaaaattgactccggggatttggctcgca
ccctttctcgtccgaaaaaaatccgaattctatcagaaatatcccgaagctatcctcaaa
gatcgggacggaaagcccgtgcctgcactttggaatcctcactggggaatggactacacc
tactgcgtcgacgtaactcatcccacctcccgagatttcctagagaacatcctaaaaacg
attgtaaaagacaacggatatcagtatctcaaactagacttcttatacgccgcccttctt
cccggttggacttacgatcggaatatctcgcctcacaaacgttatgtggatacgattcgg
ttcgtccgtaaagtcgtcggtaaagatgtgttcctccttggatgtggagcgcccatctat
ccgtcgatcggactgttcgatgcgatgagaatcggttgtgacgtggcgcctttctgggaa
agagaaaaaacgagaattctcgcaaaggacaaacatgcgctcagtaccgaaagagccttg
attaacgacattactcgctcttcgatgcacagaaacttatggtacaacgatccggattgc
cttttggttcgagaaagtaaaaatcatatgacatacgcacaaactcaattgatggcgagc
gtaatggcggtgagcggcggaatgattttcgtaagcgacgatttgtcccgagtcggagaa
gaaagactcgcgcttttaaagaaaacattagaactcggagtcaagtgcagaagtaaaact
ccagttccgatcggattcgcttccggttcgtttccatccgcgctttacaatccggcaggc
tttttaggaatttggaatccaagagaagaagaaagtacgatcgaaatccaagttcctttc
atctctaaactcaaacaatttccggattattggacaggaaaagttcccgaatccctcgag
tatttttcaagaagtggagttctcaaattaaaacttccggcatacggttccgtggtatta
caaaccgcaaaagttgtttga

DBGET integrated database retrieval system