KEGG   Leptospira borgpetersenii L550: LBL_0834Help
Entry
LBL_0834          CDS       T00405                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
lbl00020  Citrate cycle (TCA cycle)
lbl00640  Propanoate metabolism
lbl00660  C5-Branched dibasic acid metabolism
lbl01100  Metabolic pathways
lbl01110  Biosynthesis of secondary metabolites
lbl01120  Microbial metabolism in diverse environments
lbl01130  Biosynthesis of antibiotics
lbl01200  Carbon metabolism
Module
lbl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lbl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBL_0834 (sucC)
   00640 Propanoate metabolism
    LBL_0834 (sucC)
   00660 C5-Branched dibasic acid metabolism
    LBL_0834 (sucC)
Enzymes [BR:lbl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LBL_0834 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA GARS_A
Motif
Other DBs
NCBI-ProteinID: ABJ78389
UniProt: Q053V6
Position
1:complement(965358..966530)
Genome map
AA seq 390 aa AA seqDB search
MKIHEYQAKEILRRHKANVPFGIVIDKKENASKAHDEVTSKTGGSVVVVKAQIHAGGRGK
GGGVKVTKTKEDATAAVDKILGMQLITPQTGPEGKKVLKVYLEQGIDIAKEYYLSILLDR
SIRKTILMASTEGGMEIEEVAETHPEKILKIAVDPGIGLQVNQARQLAFELGLPAESHKS
FQSLVMAIYDAYIKEDASLLEINPLILTKQNEIIAGDCKIDLDENALYRHADNAAFRDIT
EEDPLEVQASEFNLNYVKLDGNIGCMVNGAGLAMATMDIVKLAGAEPANFLDVGGGANKT
TVTNGFKIILGDPNVKGIFVNIFGGIVRCDMVAEGIIEAAKAVDLKVPLVVRLQGTNSEL
GREVLNKSGLKITGVDDLREAASTIAKLIK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcacgagtatcaggcaaaagaaatcctgagaaggcacaaagccaacgttcct
tttggaatcgtaatcgacaaaaaagaaaacgcatccaaagcccatgacgaagttacctcc
aaaaccggcggttccgtcgtagtcgtaaaagcgcagatccatgcaggcggacgcggaaaa
ggcggcggtgttaaagtaaccaaaaccaaagaagacgcaaccgcagccgtagacaaaatt
ctcggaatgcagctcatcactccccaaaccggacccgaaggaaaaaaagtcctgaaagta
tatctggagcagggaatcgatatcgcaaaggaatattatctcagtatccttctcgatcgt
tccatccgtaagaccatccttatggcttccaccgaaggcggaatggaaatcgaagaagtt
gccgaaactcatcctgaaaagattttaaaaatcgccgtggatcccggaatcggacttcaa
gtgaaccaagcaagacaactcgctttcgaactcggacttcccgcagaatcgcacaagtct
tttcaaagcctcgttatggcgatctatgacgcgtatatcaaagaagacgcttctctttta
gaaatcaatcctctcattctcaccaaacagaatgaaatcatcgcgggagattgcaagatc
gacctcgacgaaaacgctctctaccgtcacgcggacaacgcggcattcagagacatcacc
gaagaggatcctctcgaagttcaggcttccgagttcaacctcaactacgtcaagttagac
ggcaacatcggttgtatggtcaacggagccggactcgcgatggcgaccatggacatcgta
aaactcgcgggcgcggaacctgcgaactttttggacgtaggaggcggggcgaacaaaacc
actgtaaccaacggattcaaaatcatcctcggtgatccgaacgtaaaaggaatcttcgta
aacatcttcggcgggatcgttcgttgcgacatggtcgcggaaggaatcatcgaagcggct
aaagccgtggatttgaaagttcctctcgtggttcgtctccaaggaaccaactcggaactc
ggaagagaagtcctcaacaaaagcggactgaaaattaccggagtcgacgacctccgcgaa
gcggcaagcaccattgccaaactgatcaagtaa

DBGET integrated database retrieval system