KEGG   Leptospira borgpetersenii L550: LBL_0928Help
Entry
LBL_0928          CDS       T00405                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
lbl00260  Glycine, serine and threonine metabolism
lbl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lbl01100  Metabolic pathways
lbl01110  Biosynthesis of secondary metabolites
lbl01130  Biosynthesis of antibiotics
lbl01230  Biosynthesis of amino acids
Module
lbl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBL_0928 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LBL_0928 (trpB)
Enzymes [BR:lbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LBL_0928 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABJ78469
UniProt: Q053M6
Position
1:1071640..1072842
Genome map
AA seq 400 aa AA seqDB search
MGKVRHSPKEGYFGEFGGRYSPEILHDALAELETTYKKLKKNKHFKKELEYYRKNYIGRP
SPLTYAERLTKVWDGARIWLKREDLNHTGAHKINNTIGQVLIAKAMGKTRIIAETGAGQH
GVATATVGAMFQMETVVYMGEEDLRRQELNAIRMRMMGAKVVGVSSGTATLKDATSEAMR
DWALNVSNTHYIVGSSIGPHPFPTIVRDFQSVIGIESRKQFKKVNGKLPNAVIACVGGGS
NSIGMFYGFLRDKKVKLFGVEAGGYSTEPGHHSATIQFGRTGFLHGTKTLVIQDEFGQIV
PAHSVSAGLDYPGVGPEHAYFHKSGRVTYVNVDDDGALDAFLEICQIEGIIPALETAHAF
RFAKDLAKSMGKKEDILICLSGRGDKDVAEVARLRKGEFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtacgtcattccccaaaagaaggttacttcggagaattcggcggtcgctat
tctcctgaaatccttcacgacgctcttgcggaacttgagaccacatacaaaaagctcaag
aaaaataaacacttcaaaaaagaactcgaatattatcgtaagaattatatcggaagacct
tctccgcttacatacgcggaacgtctcaccaaggtctgggacggtgcgagaatctggctc
aaacgagaagatttgaatcatacaggcgctcataagatcaacaatacgatcggacaagtg
ttgatcgcaaaggcgatgggcaaaactcgaattattgcggaaaccggagcggggcaacac
ggggttgcgaccgcaaccgtgggtgcgatgtttcagatggaaacagtcgtttatatggga
gaagaggatcttcgtcgccaggaactcaacgcgatccggatgagaatgatgggcgccaaa
gtcgtaggtgtttcaagcggaaccgcaactctcaaagacgctacgagcgaagcaatgcgc
gattgggcattaaacgtttctaatacacattatatcgttggttcttccatcggtcctcat
ccgtttcctaccatcgtaagagactttcaatcggtaatcggcatcgaatccagaaaacaa
tttaaaaaagtgaacggtaaacttccaaacgctgtgatcgcctgtgtcggcggcggttcg
aactcgatcggtatgttctacggtttcttaagggataagaaggtgaaactttttggcgta
gaagccggaggttattctaccgaacctgggcatcattctgcaacaatccaattcggtaga
accgggtttttacatggaaccaaaacgttggtgatccaagatgaattcggacaaatcgtc
ccggcacattccgtgtctgcaggtttggattatcctggggtcggtccggagcacgcttat
tttcataaaagcgggagagtgacttacgtgaacgtggatgatgacggtgctttagatgct
tttctcgagatatgtcagatcgaaggaatcattcctgcattagaaactgctcatgcgttt
cgttttgcaaaagatctggcgaaatcgatggggaaaaaagaagacattctcatctgcctt
tccggaagaggagataaggatgttgccgaggttgcaaggcttagaaaaggagaattttct
tga

DBGET integrated database retrieval system