KEGG   Leptospira borgpetersenii L550: LBL_0929Help
Entry
LBL_0929          CDS       T00405                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
lbl00260  Glycine, serine and threonine metabolism
lbl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lbl01100  Metabolic pathways
lbl01110  Biosynthesis of secondary metabolites
lbl01130  Biosynthesis of antibiotics
lbl01230  Biosynthesis of amino acids
Module
lbl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBL_0929 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LBL_0929 (trpA)
Enzymes [BR:lbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LBL_0929 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA DUF561 His_biosynth BtpA Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ABJ78470
UniProt: Q053M5
Position
1:1072839..1073633
Genome map
AA seq 264 aa AA seqDB search
MSAISSVFSSDKSVFIPYISLGDPDYESCISWADALIRGGAGILELGIPFSDPVADGPVI
QKAFKRALAYPFSMKKILEITAEIHKLHPETPLVYLTYFNPLYSMGLEAFTESAKNSGIQ
GLIIPDLPFDTSEAEEFFSQLERKKIDFIHLVTPATTIDRIQSMKSFASGFIYYVTSYGV
TGERRALAVGLKERIQMVRNKVGLPVCAGFGISTADQAKEISTYANGVIIGSAVQKIIEE
SGSNREVCISKLFTYASEIRASMK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgctatttcttccgttttttcctccgataaaagcgttttcattccttatatctct
ttgggagatccggactacgagtcttgtatttcttgggcggatgctctgattcgaggtggt
gctggaattttagaattgggaattccattttccgatccggtcgcggatggcccggtgatt
caaaaagcctttaaacgagcgttggcttatcctttctccatgaaaaaaattttagagatc
accgcagaaattcataaattacatccagaaactcctctcgtgtatttaacgtattttaat
ccgctttattctatgggtttggaagcttttacggagagtgcaaaaaattcggggatccaa
ggtttgattatcccggaccttccgtttgacacctcggaagcagaagagtttttttctcaa
cttgaacgaaaaaagatcgatttcattcatcttgtaactcctgcaactactatcgatcgg
attcaatctatgaaatcttttgcatccggttttatctattatgtgacttcctacggtgtc
accggggaacgtcgtgctctcgcggtcggtttgaaagaacggattcaaatggtgcgtaac
aaggtcggcctcccggtttgcgcggggttcggaatttccactgcggaccaggctaaggaa
atttcgacttacgcgaatggggtgattatcggttctgccgtacaaaaaatcatcgaagag
agtggctccaatcgggaagtttgcataagtaaactttttacgtatgcatcggaaattcgt
gcttctatgaaatga

DBGET integrated database retrieval system