KEGG   Leptospira borgpetersenii L550: LBL_0978Help
Entry
LBL_0978          CDS       T00405                                 

Gene name
mauG-4
Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lbl  Leptospira borgpetersenii L550
Brite
Enzymes [BR:lbl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     LBL_0978 (mauG-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1141320..1142507)
Genome map
AA seq 395 aa AA seqDB search
MEFLLYSISLLFLIQCGSGILPFAPFDKKKSDRNEALLLLLIPQNSYVWNLPPGFPVPVV
PSSNPMTQEKVDLGRFLFYDKRLSGNQTQSCASCHNQSIAFTDGLTTAVGSTGDVHPRNT
QGIINVAYNARQTWVNPTLKDLEDQMLVPMFGEHPVELGLANRENEMLDRLRAENRYQTL
FRKAFPLEDPFSVSNVVKAIACFERTLISGRSPYDKFLYDGNVAALGNQKASIIRGAQIF
FSEKGECFHCHGGFNFAETSVHVGAVSAEVNFHNNGLYNIGGNYPPDNQGLFEFTGVISD
KGKFRAPSIRNIELTAPYMHDGSIDTLENVVEHYNAGGRNIINGPRAGDGRTNPNKNGFV
FAIGLTAGEKTDLVNFLKSLTDTEFVNDPKHSDPF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggagtttttattatattctatttctttactatttttgattcagtgcggatcaggaatt
cttccttttgctcctttcgataagaagaaatcggatcgaaacgaagcccttctgcttctt
ctgattccgcaaaattcgtacgtttggaatctacctcccggatttccggttccggtcgtt
ccgtcttccaatccgatgactcaagagaaagtggatctcggcagatttttattttatgat
aaaaggctttcgggtaatcagactcagtcttgcgcgtcttgtcacaatcaatcaatcgcc
tttacggacggtctgacaaccgccgttggttccacgggagacgttcatcccagaaacaca
cagggaatcatcaatgtcgcgtataacgcccgtcaaacatgggtcaatccgactctaaaa
gacctggaagatcagatgctcgttccgatgttcggagaacatcctgtggaactaggcctt
gccaaccgggaaaacgaaatgcttgatcgtttgagagcggagaatcggtaccaaaccttg
tttcgaaaagcctttccgttggaagatcctttttccgtttctaacgtcgtaaaagcgatc
gcctgttttgaaagaacccttatatcgggacgttctccttatgataaatttttatacgac
ggaaacgttgcggcactcggtaaccaaaaagcttccatcattcggggggctcagattttc
ttttcggaaaagggagaatgttttcattgccacggaggttttaatttcgccgaaacgagc
gtacatgtcggagccgtttccgcagaagtcaattttcataacaacggcctttacaatatc
ggcgggaactatcctcccgacaatcagggtttgttcgagtttacgggagtgatttccgat
aaaggtaaatttcgggcgccttccattagaaatattgaattgaccgctccctatatgcac
gacggttcgatcgacactctggagaacgtagtggaacactacaacgccggtggaagaaac
atcatcaacggacctcgcgcaggagacggaagaacaaatccgaataagaacggttttgtg
ttcgcgatcggccttaccgccggggaaaaaacggacctcgtaaatttcttgaaaagttta
acggatacggaattcgtaaatgacccgaaacacagcgaccctttttaa

DBGET integrated database retrieval system