KEGG   Leptospira borgpetersenii L550: LBL_1269Help
Entry
LBL_1269          CDS       T00405                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
lbl00010  Glycolysis / Gluconeogenesis
lbl00051  Fructose and mannose metabolism
lbl00562  Inositol phosphate metabolism
lbl01100  Metabolic pathways
lbl01110  Biosynthesis of secondary metabolites
lbl01120  Microbial metabolism in diverse environments
lbl01130  Biosynthesis of antibiotics
lbl01200  Carbon metabolism
lbl01230  Biosynthesis of amino acids
Module
lbl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lbl_M00002  Glycolysis, core module involving three-carbon compounds
lbl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBL_1269 (tpiA)
   00051 Fructose and mannose metabolism
    LBL_1269 (tpiA)
   00562 Inositol phosphate metabolism
    LBL_1269 (tpiA)
Enzymes [BR:lbl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LBL_1269 (tpiA)
Exosome [BR:lbl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LBL_1269 (tpiA)
  Exosomal proteins of bladder cancer cells
   LBL_1269 (tpiA)
  Exosomal proteins of melanoma cells
   LBL_1269 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABJ78767
UniProt: Q052H8
Position
1:complement(1491099..1491851)
Genome map
AA seq 250 aa AA seqDB search
MRKTVIAGNWKMNLSEKEALSLAHSIKEKIPAISKGRISMIFPSTLHLAGVAKILQGTEI
LVGAQNVYPSGLAAFTGETSPEQLKELGVKVVMIGHSERRQFLGETNSFCNEKIHFLLKN
DFIVLYCVGETLMERESGKTFEVISSQIREGLKGIHSHSFSNLILAYEPVWAIGTGKVAT
PAQAQEVHFFIRKEIAGLFLGAKEIAESISILYGGSVKPDNIQTLLKEKDLDGGLVGGAS
QKIDTYAGLF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaacggtaatcgccggaaactggaaaatgaatctctccgaaaaagaggctcta
tctctggcacattcgattaaagaaaagatccctgccatttctaaaggtagaatttctatg
atttttccttcgacattgcatcttgcgggtgttgcgaaaattttacaaggaacagaaatt
ctagtcggagcgcagaatgtgtatccttccgggcttgcggcctttaccggtgaaacctca
ccggaacaactaaaagaactcggcgtgaaggtcgttatgatcggacattcggaaagaaga
caatttctaggcgagacgaattccttttgtaacgaaaagattcatttcttattaaagaac
gattttatcgtactctattgtgtaggcgaaactcttatggaaagagaatccggaaaaacc
ttcgaagtaatttcttcccaaattcgagaaggtttgaaaggaatccacagtcattctttt
tccaatctgatcctagcttatgagccggtctgggcgatcggaaccggaaaagtggcaaca
ccggcacaagcacaagaggtacacttttttattcgtaaggaaatagccggtctattctta
ggtgcgaaagaaattgcggaatccatctcaattctatacggaggttccgtaaaaccggat
aacatacaaacgctcttaaaggaaaaagatctagacggcgggctcgtaggaggagccagt
caaaaaatagatacttacgcgggtttgttctga

DBGET integrated database retrieval system