KEGG   Leptospira borgpetersenii L550: LBL_1269Help
Entry
LBL_1269          CDS       T00405                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBL_1269 (tpiA)
   01230 Biosynthesis of amino acids
    LBL_1269 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBL_1269 (tpiA)
   00051 Fructose and mannose metabolism
    LBL_1269 (tpiA)
   00562 Inositol phosphate metabolism
    LBL_1269 (tpiA)
Enzymes [BR:lbl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LBL_1269 (tpiA)
Exosome [BR:lbl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LBL_1269 (tpiA)
  Exosomal proteins of bladder cancer cells
   LBL_1269 (tpiA)
  Exosomal proteins of melanoma cells
   LBL_1269 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1491099..1491851)
Genome map
AA seq 250 aa AA seqDB search
MRKTVIAGNWKMNLSEKEALSLAHSIKEKIPAISKGRISMIFPSTLHLAGVAKILQGTEI
LVGAQNVYPSGLAAFTGETSPEQLKELGVKVVMIGHSERRQFLGETNSFCNEKIHFLLKN
DFIVLYCVGETLMERESGKTFEVISSQIREGLKGIHSHSFSNLILAYEPVWAIGTGKVAT
PAQAQEVHFFIRKEIAGLFLGAKEIAESISILYGGSVKPDNIQTLLKEKDLDGGLVGGAS
QKIDTYAGLF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaacggtaatcgccggaaactggaaaatgaatctctccgaaaaagaggctcta
tctctggcacattcgattaaagaaaagatccctgccatttctaaaggtagaatttctatg
atttttccttcgacattgcatcttgcgggtgttgcgaaaattttacaaggaacagaaatt
ctagtcggagcgcagaatgtgtatccttccgggcttgcggcctttaccggtgaaacctca
ccggaacaactaaaagaactcggcgtgaaggtcgttatgatcggacattcggaaagaaga
caatttctaggcgagacgaattccttttgtaacgaaaagattcatttcttattaaagaac
gattttatcgtactctattgtgtaggcgaaactcttatggaaagagaatccggaaaaacc
ttcgaagtaatttcttcccaaattcgagaaggtttgaaaggaatccacagtcattctttt
tccaatctgatcctagcttatgagccggtctgggcgatcggaaccggaaaagtggcaaca
ccggcacaagcacaagaggtacacttttttattcgtaaggaaatagccggtctattctta
ggtgcgaaagaaattgcggaatccatctcaattctatacggaggttccgtaaaaccggat
aacatacaaacgctcttaaaggaaaaagatctagacggcgggctcgtaggaggagccagt
caaaaaatagatacttacgcgggtttgttctga

DBGET integrated database retrieval system