KEGG   Leptospira borgpetersenii L550: LBL_1298Help
Entry
LBL_1298          CDS       T00405                                 

Definition
chemotaxis protein, methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LBL_1298
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    LBL_1298
Enzymes [BR:lbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     LBL_1298
Two-component system [BR:lbl02022]
 CheA family
  CheA-CheYBV
   LBL_1298
Bacterial motility proteins [BR:lbl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    LBL_1298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1524026..1524586
Genome map
AA seq 186 aa AA seqDB search
MKYEAIVIGVSAGGMNAMKTILPSLPAGYGIPLILVQHIGPRSDGTWIRVLRDFSRIKIK
EAEEKEKIEPGTVYVAPPNYHLLIEKDKTVSLSTSERVNFSRPSIDVLFESASDAYGDGL
IGIVLTGANSDGAKGLKKIKENGGLAIVQDPLYSEVSLMPESAIRAGPVDYILSLEKIAE
LLIRLD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgaggcgattgtgataggagtttccgcaggggggatgaatgccatgaaaacg
atattgccgtctttacccgcgggatacggaattccgttgatcctcgttcagcatatcggt
ccccgttccgacgggacgtggattcgggttctccgggatttttctaggatcaaaatcaaa
gaggcggaggaaaaggaaaagatcgaaccgggaacggtttatgtagctccgcctaattat
catttattgattgaaaaagataaaacggtttccctttcaactagcgagcgagtgaatttt
tcgaggccttctatagacgttttatttgaatccgcttcggatgcttatggtgacgggttg
atcggaatcgttttaacgggtgcaaattcggacggtgcaaagggtttaaaaaagataaaa
gaaaacggcggtttggcgatcgttcaagatccattatactccgaggtttctttgatgccg
gagtcggctatcagggcggggccggtggattatatactttctttggaaaagattgcggag
ctactgataagattggattaa

DBGET integrated database retrieval system