KEGG   Leptospira borgpetersenii L550: LBL_1393Help
Entry
LBL_1393          CDS       T00405                                 

Gene name
glpK-1
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lbl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1624605..1626095
Genome map
AA seq 496 aa AA seqDB search
MSDYIIGIDAGTTGIRIFCFNRSGNVISSSYSEFKQYYPKSGWVEHDAEEIWAKTEKLII
KAIRNGKLSPSKAVAIGITNQRETTVLFDKDTGKPVYNAIVWQCRRTAGICKDLKSKGLE
PLFRKKTGLVLDAYFSGTKIQWILENVKGVKARAEKGKILFGTVDTYLLHRLTNGKSHKT
DHTNASRTLVYNIEKKEWDKELTQILGIPDSILPEAHNSSSLFGRTEKVKGLLDGIPISS
LVGDQQGALFGQLCTEPGEAKNTYGTGCFLLFNTGNNFQISRNNLLTTLGCGPEGKTVYC
LEGSVFIGGAVVQFLRDNLKFFKESKISEKFASSVKKEDEIIFVPAFTGLGAPYWDMNAR
GAILGLTRDTTPEQITKAALKSIALQSYELVEAMENDTGSKLKVLKVDGGATGNSWLMQY
QSDVLGKRVIRPSNVDTTVLGAAFLAGLERGFFPSVADLKKKIKVNKEFFPQMKVAQRER
EIQIWKDSVRRIRTDQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattatatcattgggattgatgctggaaccactgggattcgaattttttgtttt
aacagatccgggaacgtgatttcgagttcctattccgaattcaaacaatactatccgaaa
tcgggttgggtggaacatgacgcggaagagatctgggcaaaaactgaaaaactgatcatc
aaagcgattcgtaatggaaaattaagtccttctaaggccgtcgcgatcggaatcacaaat
caaagagaaaccaccgtcttgttcgataaggatacgggcaagccggtttataatgcaatt
gtatggcaatgtaggagaaccgccggaatttgtaaggatctaaagtcgaaaggtttggag
ccgcttttccgtaaaaaaacggggctcgttttggacgcatacttcagcggaacaaaaatt
caatggattctggaaaatgtgaaaggtgtgaaagcgagagccgagaagggaaaaatactt
tttggaaccgtcgatacgtatttgctccaccggttgaccaatggaaaatcgcataaaacc
gatcatacgaatgctagtaggacactagtctacaatatagaaaagaaggaatgggacaag
gaattgactcagattcttggaattccggattctattcttcccgaagcgcataactctagt
tctcttttcggaagaacggagaaggtgaaaggacttctggacggaattccgatttcttct
ctcgttggagatcagcagggagccttattcggtcaactctgcacggaaccgggggaagcg
aaaaatacctacggaaccggatgttttcttttgtttaacactggaaataattttcagatt
tcaagaaacaatctccttacaactcttgggtgtggtccggaaggaaagacggtttattgt
ttggaaggttccgtttttatcggaggcgccgtcgttcaatttttgagagacaaccttaag
tttttcaaagagtccaagatttccgaaaaattcgcttcctccgttaagaaggaagatgaa
attatatttgttcccgcattcactggattaggtgctccttactgggatatgaatgcaaga
ggtgcgattttgggtctaacgagagatacaactccggaacaaattacgaaagccgcgttg
aaatcgattgcacttcaatcttatgaactggtggaagcgatggagaacgataccggctca
aagctaaaagtcctcaaagtggatgggggcgccaccggaaactcctggctgatgcagtat
caatccgatgtgttaggaaaacgcgtaattcgtccttcgaatgtagatacgaccgtattg
ggtgcggcttttttagccgggcttgaaagaggattttttccctctgttgcggatctgaaa
aagaaaatcaaagtaaataaagagtttttccctcagatgaaagtggcacagagagaaagg
gaaattcagatttggaaggattccgtacgaagaatccgcaccgatcaataa

DBGET integrated database retrieval system