KEGG   Leptospira borgpetersenii L550: LBL_1393Help
Entry
LBL_1393          CDS       T00405                                 

Gene name
glpK-1
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBL_1393 (glpK-1)
Enzymes [BR:lbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LBL_1393 (glpK-1)
Exosome [BR:lbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBL_1393 (glpK-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1624605..1626095
Genome map
AA seq 496 aa AA seqDB search
MSDYIIGIDAGTTGIRIFCFNRSGNVISSSYSEFKQYYPKSGWVEHDAEEIWAKTEKLII
KAIRNGKLSPSKAVAIGITNQRETTVLFDKDTGKPVYNAIVWQCRRTAGICKDLKSKGLE
PLFRKKTGLVLDAYFSGTKIQWILENVKGVKARAEKGKILFGTVDTYLLHRLTNGKSHKT
DHTNASRTLVYNIEKKEWDKELTQILGIPDSILPEAHNSSSLFGRTEKVKGLLDGIPISS
LVGDQQGALFGQLCTEPGEAKNTYGTGCFLLFNTGNNFQISRNNLLTTLGCGPEGKTVYC
LEGSVFIGGAVVQFLRDNLKFFKESKISEKFASSVKKEDEIIFVPAFTGLGAPYWDMNAR
GAILGLTRDTTPEQITKAALKSIALQSYELVEAMENDTGSKLKVLKVDGGATGNSWLMQY
QSDVLGKRVIRPSNVDTTVLGAAFLAGLERGFFPSVADLKKKIKVNKEFFPQMKVAQRER
EIQIWKDSVRRIRTDQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattatatcattgggattgatgctggaaccactgggattcgaattttttgtttt
aacagatccgggaacgtgatttcgagttcctattccgaattcaaacaatactatccgaaa
tcgggttgggtggaacatgacgcggaagagatctgggcaaaaactgaaaaactgatcatc
aaagcgattcgtaatggaaaattaagtccttctaaggccgtcgcgatcggaatcacaaat
caaagagaaaccaccgtcttgttcgataaggatacgggcaagccggtttataatgcaatt
gtatggcaatgtaggagaaccgccggaatttgtaaggatctaaagtcgaaaggtttggag
ccgcttttccgtaaaaaaacggggctcgttttggacgcatacttcagcggaacaaaaatt
caatggattctggaaaatgtgaaaggtgtgaaagcgagagccgagaagggaaaaatactt
tttggaaccgtcgatacgtatttgctccaccggttgaccaatggaaaatcgcataaaacc
gatcatacgaatgctagtaggacactagtctacaatatagaaaagaaggaatgggacaag
gaattgactcagattcttggaattccggattctattcttcccgaagcgcataactctagt
tctcttttcggaagaacggagaaggtgaaaggacttctggacggaattccgatttcttct
ctcgttggagatcagcagggagccttattcggtcaactctgcacggaaccgggggaagcg
aaaaatacctacggaaccggatgttttcttttgtttaacactggaaataattttcagatt
tcaagaaacaatctccttacaactcttgggtgtggtccggaaggaaagacggtttattgt
ttggaaggttccgtttttatcggaggcgccgtcgttcaatttttgagagacaaccttaag
tttttcaaagagtccaagatttccgaaaaattcgcttcctccgttaagaaggaagatgaa
attatatttgttcccgcattcactggattaggtgctccttactgggatatgaatgcaaga
ggtgcgattttgggtctaacgagagatacaactccggaacaaattacgaaagccgcgttg
aaatcgattgcacttcaatcttatgaactggtggaagcgatggagaacgataccggctca
aagctaaaagtcctcaaagtggatgggggcgccaccggaaactcctggctgatgcagtat
caatccgatgtgttaggaaaacgcgtaattcgtccttcgaatgtagatacgaccgtattg
ggtgcggcttttttagccgggcttgaaagaggattttttccctctgttgcggatctgaaa
aagaaaatcaaagtaaataaagagtttttccctcagatgaaagtggcacagagagaaagg
gaaattcagatttggaaggattccgtacgaagaatccgcaccgatcaataa

DBGET integrated database retrieval system