KEGG   Leptospira borgpetersenii L550: LBL_2167Help
Entry
LBL_2167          CDS       T00405                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBL_2167
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBL_2167
   00052 Galactose metabolism
    LBL_2167
   00500 Starch and sucrose metabolism
    LBL_2167
   00520 Amino sugar and nucleotide sugar metabolism
    LBL_2167
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LBL_2167
   00524 Butirosin and neomycin biosynthesis
    LBL_2167
Enzymes [BR:lbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LBL_2167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2546058..2546954
Genome map
AA seq 298 aa AA seqDB search
MKSYLGIDIGAGSIKASLVAEDGTILGSTSRTTGAETDETQFLDSLAGIVSEMKNSSLAA
VGIGSPGPIDCENGILIQSANLPLLKNVALVDHLKKKFSIPVYYNNDANLAALGEYRFGL
GKGSPSLVILTLGTGLGGGWVYQGKLFDGYKGSGMEAGHVTYIPNGPLCGCGQRGCTEAY
FSASGFLNRYQEKTGNSLNSAEEFFDRNRKGETVASILLNEGIEALAQLCRGLIHTINPE
KIVFTGGLVYSWDLFGNSLKERIQELIFPIFRTYTQILPGGNISGTLGAAALCMENQK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcttatctcggaatcgatatcggagcgggaagcatcaaggcgagtctagtagcc
gaggacggaaccattttaggaagtacgtcccgcacaacgggagcggaaaccgatgagact
caattcttagattcccttgccggtatcgtatcggaaatgaaaaattcctcgttagccgcg
gttggaatcggaagtcccggacccatcgactgcgaaaacggaatcctaattcaatcggca
aatctacctcttttgaaaaatgtagcgttagtcgatcatttaaaaaaaaaattttccatc
ccggtctactacaataatgacgcaaacctcgccgcacttggagaatatcgtttcggtctt
ggaaaaggatccccgagtttggtgattcttactttaggaacgggactcggaggaggctgg
gtatatcaaggaaaattatttgacggctacaaaggaagcggaatggaagcgggacacgtt
acgtatattccaaacggccccctctgcgggtgcggacaaagaggatgtacggaagcgtat
tttagcgcaagcgggttcttaaatcgatatcaggaaaaaacgggaaattccttaaactcc
gccgaagaatttttcgataggaatcgaaaaggggaaaccgtcgcatcaattttattaaac
gaaggaatcgaagccctcgcacaactctgtcggggactcattcataccattaatccggaa
aagatcgtctttacgggaggacttgtgtattcttgggatctattcggcaactcccttaaa
gaaagaattcaagaacttatctttccgattttcagaacttatacccaaattctgcccgga
ggaaacatatccggaaccttaggcgcagcggcgctttgtatggagaaccaaaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system