KEGG   Leptospira borgpetersenii L550: LBL_2345Help
Entry
LBL_2345          CDS       T00405                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lbl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lbl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2783365..2784291
Genome map
AA seq 308 aa AA seqDB search
MSYNHKNVLDTEQFSKSDLDFLIKKIKDMEHLVERHKAFGILTGKLLASLFFEASTRTRL
SFEAAMERLGGRVISTVGFQFSSISKGETLYDTMKMVEAYADIAVIRHPVEGSSRIAAGA
VKIPVVNAGDGAGQHPTQAILDLYTIISEKGTLDGLSVAFIGDLKYGRTIHSLINLLRHY
KVRLYLISPIELALPDSYKKGLEGYPLTLEETTDIKAVWECDVAYVTRIQEERFPDHKEY
ERLKDLFKINKELILASKKETTILHPLPRVNELSTDVDDLPNAAYFRQARYGVVSRMTLL
CLCLGQDF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtcctataaccacaaaaatgtcctagatacggaacagttttctaaatcggatctcgac
ttcctcatcaagaaaatcaaggatatggagcacctcgtcgagcggcacaaggcgttcgga
atcttaaccggaaaacttttagcctccctctttttcgaggcttcgacaagaactagactt
tctttcgaagcggcgatggaacgcctcggaggtagagtgatctccacagtcggttttcag
ttttcctcgatttccaaaggagaaacgttatatgacaccatgaaaatggtagaagcttac
gcggacatcgcggtgattcgtcatcccgtcgaaggctcttctagaatcgcggctggagcg
gtaaaaattccggtcgtcaacgcgggggacggagcaggacaacaccctactcaggcgatt
ctggatctttatacgatcatttccgaaaaaggaacgttagacggattgtcggtcgctttt
atcggagatttgaagtatggaagaacgattcattcgcttatcaaccttctcaggcactac
aaggttcgtctgtatctgatttctcctatagaactcgccttgcccgattcgtacaaaaaa
ggtctggaaggttaccctctcactctggaagaaacgaccgacatcaaagccgtctgggaa
tgcgacgtcgcttatgtaactcgaattcaggaagaaagatttccagatcacaaggaatac
gaaaggctcaaggatctttttaaaatcaacaaggagttgattcttgcttccaagaaagag
acgacgattcttcaccctcttccgagagtgaacgaactttccacggacgtggatgatttg
ccgaatgcggcatatttcagacaagcaagatacggagtcgtaagtcgtatgaccctactt
tgtctttgtttaggacaggacttctga

DBGET integrated database retrieval system