KEGG   Leptospira borgpetersenii L550: LBL_2396Help
Entry
LBL_2396          CDS       T00405                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LBL_2396 (recD)
Enzymes [BR:lbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LBL_2396 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2842121..2843971
Genome map
AA seq 616 aa AA seqDB search
MMEESFSHFIEKLKADILDLYESGALKKIPENFSDYLLEILNSIWSSMEEGSLCVPVKKE
WRDVLKLKPPGLVVDKFENQEWVYFEKTHRSKTDLESLLKERIQNDVPPKVDRHRAEKIL
KNLESKSFPLKEAQVKTILSCLNSSFHIVSGGPGTGKTTVVAFLLEILNQLGQLPSPEEI
ALVAPTGRAAQRLTESIQENLKKISEMKGSDFLRGQTVHGLLSYKSSLGGFYYNRERYLP
HRLIIVDEVSMVDLNLMLSLWNAIPRDTKKDDRKIPLRFILIGDPHQLPSVEKGAVLSDF
LSVLESKKANFASRLEGSNRQKSKGNVSKIVVLAEEILGYSPENLNLGTKIDDSFPKTTT
IGENSKYESEVVWLQNPANKTSDHLSRDEVVEKLWTEIFHPGISKIGTWKVKDSFDLNEA
GFILKFQEELKKFRCLTVFRNGYWGVEAIQTKIMNLAAQDLFHRKDQKPDFFAKRLSKRL
YFIGLPILITQNDKNRKLFNGDIGIVLRMESTGELRAVFPIEGKLLPFALDTLPKHEPAF
VMSIHKSQGSEYDTILIYIPDHPESQEKERSHRLLNRQILYTGITRAKNQVILAGNPKTW
EIGIANSQKRNTGFKI
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
ttgatggaagagtcgttctcccattttattgaaaaactcaaagcggacattttagacttg
tacgaatccggggccctgaaaaaaattcccgaaaatttttcggattatttattagaaatt
ctgaattcgatttggagttccatggaagagggaagtttatgcgtccccgtaaaaaaggaa
tggagggacgttttaaaattaaaacctcccggtttagtcgtggacaaattcgaaaaccag
gaatgggtttacttcgaaaaaacgcatcgatccaaaaccgatctggaaagtctcctaaag
gaaaggattcaaaacgacgttccgccgaaagtcgaccgacaccgtgccgagaaaattctc
aaaaatctggaatcaaaaagttttccattaaaagaagcgcaggtaaagacgattctttcc
tgtctcaattcctcctttcacatcgtcagcggaggcccgggaaccggaaaaacgacggtc
gtcgcatttctattagaaattttgaatcaactgggacaacttccttctcccgaagaaatc
gcgctcgtggcgcctacgggaagagctgcacaaagattaacggaatcgattcaggaaaac
ctaaaaaaaatctccgaaatgaaaggatccgatttcttacggggacaaactgttcacgga
cttctctcctacaaatcgtcgttaggcggattttattacaaccgggaaagataccttccg
catcgattgatcatcgtggacgaagtttcgatggtcgatttaaatctgatgctttcctta
tggaacgcaatccctcgcgataccaaaaaagacgaccgaaaaattccgctccgattcata
ctgatcggagatccgcatcaacttccttccgtggaaaagggcgcggtattaagcgacttt
ttatccgtactagaatcgaaaaaagcgaattttgcctccagactcgagggaagcaatcgt
caaaaatcgaaggggaacgtttcaaaaatcgtcgttcttgcggaagaaatcctcggatat
tcccccgaaaacctaaatctcggaacaaagatagacgattcttttccgaaaacgacgacg
atcggagagaattcgaaatatgaaagcgaagttgtatggttgcaaaatcccgcaaataaa
acttcggatcacttatcgagagacgaagtcgttgaaaaactttggaccgaaatttttcat
cccgggatttccaaaattgggacttggaaagtcaaggattctttcgacttaaacgaggcc
ggctttattttaaaatttcaggaggagttgaaaaaattccgctgtcttaccgtttttaga
aacggttattggggagtggaagcgattcaaacgaaaattatgaatctggccgcgcaggat
ctttttcatagaaaagaccaaaaaccggattttttcgcaaaacgcctttccaaacgtctt
tactttatagggcttcccatcttaatcacgcaaaacgataaaaacagaaaacttttcaac
ggcgatatcggtatcgttttaagaatggaatcgaccggagaactcagagcggtttttccg
atcgaaggtaaattattgcctttcgcgttagacactcttccgaaacacgaacccgcattc
gtgatgagcattcacaaaagtcagggatcagaatatgatacaattctaatctatattccg
gatcatccggaatctcaggaaaaggaacgatctcatagacttctcaaccgtcagatttta
tacactggaatcacaagagccaaaaaccaagtaattcttgcgggcaacccgaagacctgg
gaaatcggaatcgccaattctcagaagagaaacaccggttttaaaatttaa

DBGET integrated database retrieval system