KEGG   Leptospira borgpetersenii L550: LBL_2877Help
Entry
LBL_2877          CDS       T00405                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lbl00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lbl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3430371..3431669
Genome map
AA seq 432 aa AA seqDB search
MRSSYFKIIGKTPLHGTVVPQGNKNEALPLLGAVCMVPGTVRISNIPVISDVLMLMEVLR
HLGMEITEEEPGTYTFKHDGNLKNQLPEELCSRIRGAVTLAGPILAITGRVFLPKPGGDK
IGRRRLDTHLLALQALGANIEVFPDGYEIKADQLRGTDILMDEASVTGTENAVMAAVLAE
GVTILRHAASEPHVQRLCHFLNSAGAKISGIGSNILTIEGVTSLKPPAKEHKIGSDYLEV
GSFISLAAVTGGELMIRDVELEDIRMIRMVYSRLGIEVRPHENGILVPSDQKMEITPDYH
GATPKIDDSPWPGFPADMTSVALVTATQCKGTVLIHEKMFESRLFFVDNIIAMGAQIILC
DPHRAIVIGHSRLYGQKVASPDIRAGMAMIIAALCAEGTSTIHNIGQVDRGFENIDTRLR
ALGARIERVNAD
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagatcttcgtatttcaagatcattggaaaaacccctcttcatggaacagtggttcca
cagggaaataaaaatgaagctttgccattactcggtgcagtttgtatggttccgggaacc
gttcgtattagcaacatcccggttatctcagacgtactcatgctcatggaagttctccgc
cacttaggtatggaaatcactgaagaagaacctggaacttacactttcaaacacgacggt
aatctaaagaatcaacttcccgaagagctttgttctcgcattcgtggcgccgtcacttta
gcgggtccgattcttgcgattacgggaagagttttcttaccgaagcctggaggagataaa
ataggaagaagaagattagatactcatcttctcgcgttacaagcattaggcgccaatata
gaagtttttccggacggttacgaaattaaggcagaccaattgagaggaacggatattcta
atggacgaggcttccgtaaccggaacggaaaatgcagtaatggctgcagtccttgcggaa
ggagtcacgattcttcgacatgcggcgagtgaacctcatgtacaaagactttgtcatttt
ttaaactccgcgggagcaaaaatttctggaatcggttcaaacatccttacaatcgaagga
gtaacctctttaaaacctcccgcaaaagaacacaaaatcggatcggactatctcgaagtc
ggctcgtttatcagcttggccgctgtcacgggcggagaactgatgattcgagatgtagaa
ctggaagacattcgtatgattcgaatggtttattcccggcttggaatagaggtacgccca
catgaaaacggaatcctagttccttccgaccaaaagatggaaatcactccggattatcac
ggagctactcctaagatagacgattctccctggccaggtttccccgcggatatgacctcg
gttgctcttgtaaccgcaactcagtgtaaaggaacagttttgatccacgagaaaatgttc
gaatccagacttttcttcgtggataatatcatcgcaatgggagcccagatcattctttgc
gatcctcatagagctattgttatcggacattccagattgtatggacaaaaggtggccagt
ccggacatacgcgccgggatggcgatgattattgccgctctttgtgcggaagggacgagt
actatccataatataggtcaggtcgatcgaggttttgaaaatattgatactcgtctgcgt
gcgttaggtgcaagaatcgaaagagtaaacgcagattga

DBGET integrated database retrieval system