KEGG   Leptospira borgpetersenii L550: LBL_4010Help
Entry
LBL_4010          CDS       T00405                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lbl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:11511..12464
Genome map
AA seq 317 aa AA seqDB search
METKQRRIRLNVGLRDLASSESLNSKKLIQPLFIAEGLKEKEKMDSLPGVYRDTEVSVLK
QVESDLKAGVTHFILFLVPKSKSNSEIPKSFYERSISSLKKEFPDAFLWIDTCMCSLTTH
GHCGLLRPDGSVDNPSSVKHLSEIALTYAQSGADGIAPSDMMDGRIKSHRSVLDKNGFSN
IPILSYSTKFKSNFYGPFRAAADSAPGHGDRSSYQIDVRNREDSILSSVRDKEEGADFLM
VKPGMTSIDLIGPIREKTGLPVGAYQVSGEYASIHYLAQNGFCDFNAALCETWQIFSRAR
ASYLITYGARKGKEILS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaccaaacaaagaagaattcgccttaatgtaggactcagagatcttgcgtcttcg
gagagtctgaattcaaaaaaactaatacaacctctttttatcgcagaaggtttaaaagaa
aaagagaagatggattctcttccgggtgtttacagggacaccgaggtttccgtcttaaaa
caagtagagtcggatctcaaagcgggagtgactcattttattctttttctcgttccaaag
tccaaatccaattctgaaattccgaaatctttttacgaacgttccatctcttccttgaaa
aaggaatttcccgacgcgtttttatggatcgatacttgtatgtgttcactcacgactcac
ggccattgtggccttctgcgtccggacggaagcgtcgataacccctcttccgtaaaacat
ctttccgagatcgctttgacatatgcacagtccggtgcggatggaatcgctccgagtgat
atgatggacggaagaatcaaaagtcaccgttccgttttagataaaaacggtttttcgaat
attccaattttaagttattctactaagtttaagagcaatttttacgggccgtttcgtgcg
gcggcggattccgctccggggcacggggatcgttcttcctaccagatagacgttcggaat
cgagaggattcgattctttcctccgtgcgcgataaagaagaaggcgccgattttttaatg
gtcaaacccgggatgacttctatcgatcttatcggtccgattcgggaaaaaaccggactt
ccggtaggcgcttatcaggtcagcggagaatacgcgtcgattcactatcttgcacaaaac
ggtttttgtgattttaacgcggctttgtgcgagacctggcagattttttctagagcgaga
gcctcttatttaataacttatggagcaagaaaaggtaaggagattttatcttga

DBGET integrated database retrieval system