KEGG   Leptospira borgpetersenii L550: LBL_4110Help
Entry
LBL_4110          CDS       T00405                                 

Gene name
pfkA
Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:lbl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lbl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lbl00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lbl00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lbl00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lbl00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:lbl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:125004..126338
Genome map
AA seq 444 aa AA seqDB search
METRIQNFGQCSISSPANYEYYTSDSSRLIFKTVFQSEEDWNSYVKGNPDFFEQAGPREK
IYFSPKEVTAGIVTCGGLCPGINDVIRGIVMELYYRYGVSRILGFPYGYQGLVKKYSYEP
IELTPEKVAHIADEGGSMLSSSRGNQSPVEMVDCLGFYGVKMLFCIGGDGTLRGAREIVD
EVARRKMEISVIGIPKTIDNDINYVQKTFGFSTAFSKAMEAVECGHVEAKGAPNGIGLVK
LMGRHSGFIAVNAALASKNVNYCLIPEVNFDLYGNGAFLDDLKKRIQKKGHAVIIVAEGA
GQKFFDSTEERDPSGNLKLGDIGLFLKDTMTEFFKKENIPVNIKYIDPSYIIRSIPANAE
DSVFCGFLAQNAVHAAMAGKTDMVVGMWNNVFIHLPISLAIQERKVLQPDKSTLWRSLLA
STGQPAHMLAKHSEDRNVNYVRII
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacgaattcaaaattttggtcaatgttcgatatctagtcccgcgaattatgaa
tattacacgagtgattcctccaggttgatatttaaaactgtgtttcaatcggaagaggat
tggaattcttatgtgaaaggtaatcccgattttttcgaacaggctggacctagggaaaaa
atatatttttctcccaaagaagtgaccgccggaatcgtaacttgcggaggtttgtgcccc
ggaatcaacgacgtgattcgagggatagtaatggagctttattatcgttacggagtttcc
aggattttaggttttccctacggctaccaagggcttgtaaaaaaatattcttacgaaccg
attgaactcacgcctgaaaaagtggcgcatattgcggatgaaggcgggtctatgctctct
tcgtccagaggaaatcaatctccggtcgaaatggtggattgtctcggcttttacggagta
aagatgcttttttgtattggaggagacggcactcttcgaggcgctcgggagatcgtggat
gaggtcgcgagaagaaagatggaaatttctgtcattggaattccgaagacgatcgacaac
gatatcaactacgtacaaaaaacattcggtttttctactgcgttttccaaggcgatggaa
gcggtggaatgtggacatgtggaagcgaaaggagcgccgaatggaatcggcttggtcaaa
ctgatgggacgtcattccggattcatcgcggtaaatgcggctctcgcttctaaaaacgta
aattattgcctaattcccgaagtgaattttgacctctatggaaatggagcgtttttggac
gatctcaaaaaaagaatccaaaagaagggacacgcggttatcatcgtggcggaaggagcc
gggcagaaatttttcgattcgacggaagaaagagacccttccgggaatctgaaactgggg
gatattggtcttttcctcaaggatacgatgactgagtttttcaaaaaagaaaacattcca
gtgaacatcaaatacatagatccgagttatatcattcgatcgattccggctaacgcggaa
gattccgtattctgtggttttttggctcaaaacgcggttcacgcggcaatggccggtaaa
accgatatggttgtgggaatgtggaacaacgtgttcatacatcttccgatttctcttgcg
attcaggaaagaaaagtgttgcaaccggacaaaagtactctttggagatctcttttggct
tccacgggtcagcccgcgcatatgttggccaaacattcagaggacagaaatgtaaattac
gtcagaatcatttga

DBGET integrated database retrieval system