KEGG   Leptospira borgpetersenii L550: LBL_4129Help
Entry
LBL_4129          CDS       T00405                                 

Definition
(GenBank) Nucleotide glucose-1-phosphate uridylyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
lbl00040  Pentose and glucuronate interconversions
lbl00052  Galactose metabolism
lbl00500  Starch and sucrose metabolism
lbl00520  Amino sugar and nucleotide sugar metabolism
lbl01100  Metabolic pathways
lbl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LBL_4129
   00052 Galactose metabolism
    LBL_4129
   00500 Starch and sucrose metabolism
    LBL_4129
   00520 Amino sugar and nucleotide sugar metabolism
    LBL_4129
Enzymes [BR:lbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LBL_4129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-ProteinID: ABJ80448
Position
2:147161..148579
Genome map
AA seq 472 aa AA seqDB search
MDSMKLKVDELIQKKMAAEGLSPAFIQDFLKKTDLVRNGETGIVRWEEVGDLDPVTDEIS
LEQIEKENAPNPSILRNLVIIKLNGGLGTSMGLSGPKSLIELKDGMSFLEIVAKQSEFIQ
KKYNVSVPLILMDSFNTQSESQTELKRIGFRQKFPTSFLQHKVPRLLKENLTPIVCKNPD
DEWCPPGHGDIWISLLETGFLDTLIANGYKVAFVSNGDNLGATVHPGILSYMLKEKLEFC
MEMTPKTLADKKGGAIYKRIVHGKLENYQLLETAQVPQEHIHEFEGLGKFRTFSTNNLWI
NLIVLREKILQGNFELSLIVNPKTIEGKDVLQLETAMGSAIRNFNKIKGIIIPRDRFTPV
KKCEDYLARRSDAYCLWENYSMTMSDARKESGLGEVLITLDEKYYKKIQDFNRLFPEIPS
LVRCASLIVQGEVLFDQKVSIIGDVVIQNTGSGLRKISDLGSGVLESGKYSF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggattcgatgaaattaaaggtggatgagctcatccaaaaaaaaatggctgcggaaggt
ttgtcccccgctttcatccaggactttttgaaaaaaacggatctggttcgaaatggagaa
actggaattgttcgttgggaagaagtaggcgatctggatccggttacggacgagatctct
ctcgaacaaatcgaaaaagaaaatgctccgaatccgtcgatccttagaaatctggttatt
atcaaactgaacggaggactcggaacttcgatggggctttccggtcctaaatctttgatt
gaactgaaagacggaatgtcttttttagaaatcgtcgccaaacaatccgaattcattcaa
aagaaatataacgtgtctgttcctttgattctgatggacagtttcaatacacaaagtgaa
agtcagacggaactgaaaagaatcgggttccgacaaaaattcccgacttctttcttacag
cataaagtacctcgtcttttaaaagagaatctaacgccgattgtgtgcaaaaatcctgac
gacgaatggtgtcctccaggccacggagatatttggatttctcttttggagacgggattt
ttggacaccctcattgcaaatggatataaagttgcgttcgtatctaacggagataattta
ggagctacggtacatcccggaattctttcttatatgttgaaagaaaaattggaattctgt
atggaaatgactccgaagactcttgccgataaaaaaggcggggcgatctacaaaagaatc
gttcatggaaaactggagaattaccaacttctcgaaacggctcaagtacctcaagaacac
atacacgaatttgaaggtttgggcaaatttagaactttttcgaccaacaacctctggatc
aatttaattgttcttcgggaaaaaattcttcaaggtaattttgaactttctctgatcgta
aatccgaaaacaattgaaggaaaagacgttcttcagcttgaaaccgcaatgggatctgcg
attcgaaattttaataagatcaaggggatcattattcccagggatcgatttactcctgta
aaaaaatgtgaggattatcttgcccgaagatccgacgcgtattgtctttgggaaaactac
tcaatgacgatgtccgacgcaaggaaggaatcggggttaggcgaagtattgattactttg
gatgaaaaatactacaagaaaatccaagacttcaatcgactttttccggagatcccttct
ttggtgcgttgcgcttctctcatcgttcagggagaagtactattcgatcaaaaagtctcg
atcataggtgacgtagtgatccagaacaccggttccgggcttcgtaaaatatcggacttg
ggatcgggagttttagagtccggaaaatattccttttaa

DBGET integrated database retrieval system