KEGG   Leptospira borgpetersenii L550: LBL_4129Help
Entry
LBL_4129          CDS       T00405                                 

Definition
nucleotide glucose-1-phosphate uridylyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:lbl00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lbl00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lbl00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lbl00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:147161..148579
Genome map
AA seq 472 aa AA seqDB search
MDSMKLKVDELIQKKMAAEGLSPAFIQDFLKKTDLVRNGETGIVRWEEVGDLDPVTDEIS
LEQIEKENAPNPSILRNLVIIKLNGGLGTSMGLSGPKSLIELKDGMSFLEIVAKQSEFIQ
KKYNVSVPLILMDSFNTQSESQTELKRIGFRQKFPTSFLQHKVPRLLKENLTPIVCKNPD
DEWCPPGHGDIWISLLETGFLDTLIANGYKVAFVSNGDNLGATVHPGILSYMLKEKLEFC
MEMTPKTLADKKGGAIYKRIVHGKLENYQLLETAQVPQEHIHEFEGLGKFRTFSTNNLWI
NLIVLREKILQGNFELSLIVNPKTIEGKDVLQLETAMGSAIRNFNKIKGIIIPRDRFTPV
KKCEDYLARRSDAYCLWENYSMTMSDARKESGLGEVLITLDEKYYKKIQDFNRLFPEIPS
LVRCASLIVQGEVLFDQKVSIIGDVVIQNTGSGLRKISDLGSGVLESGKYSF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggattcgatgaaattaaaggtggatgagctcatccaaaaaaaaatggctgcggaaggt
ttgtcccccgctttcatccaggactttttgaaaaaaacggatctggttcgaaatggagaa
actggaattgttcgttgggaagaagtaggcgatctggatccggttacggacgagatctct
ctcgaacaaatcgaaaaagaaaatgctccgaatccgtcgatccttagaaatctggttatt
atcaaactgaacggaggactcggaacttcgatggggctttccggtcctaaatctttgatt
gaactgaaagacggaatgtcttttttagaaatcgtcgccaaacaatccgaattcattcaa
aagaaatataacgtgtctgttcctttgattctgatggacagtttcaatacacaaagtgaa
agtcagacggaactgaaaagaatcgggttccgacaaaaattcccgacttctttcttacag
cataaagtacctcgtcttttaaaagagaatctaacgccgattgtgtgcaaaaatcctgac
gacgaatggtgtcctccaggccacggagatatttggatttctcttttggagacgggattt
ttggacaccctcattgcaaatggatataaagttgcgttcgtatctaacggagataattta
ggagctacggtacatcccggaattctttcttatatgttgaaagaaaaattggaattctgt
atggaaatgactccgaagactcttgccgataaaaaaggcggggcgatctacaaaagaatc
gttcatggaaaactggagaattaccaacttctcgaaacggctcaagtacctcaagaacac
atacacgaatttgaaggtttgggcaaatttagaactttttcgaccaacaacctctggatc
aatttaattgttcttcgggaaaaaattcttcaaggtaattttgaactttctctgatcgta
aatccgaaaacaattgaaggaaaagacgttcttcagcttgaaaccgcaatgggatctgcg
attcgaaattttaataagatcaaggggatcattattcccagggatcgatttactcctgta
aaaaaatgtgaggattatcttgcccgaagatccgacgcgtattgtctttgggaaaactac
tcaatgacgatgtccgacgcaaggaaggaatcggggttaggcgaagtattgattactttg
gatgaaaaatactacaagaaaatccaagacttcaatcgactttttccggagatcccttct
ttggtgcgttgcgcttctctcatcgttcagggagaagtactattcgatcaaaaagtctcg
atcataggtgacgtagtgatccagaacaccggttccgggcttcgtaaaatatcggacttg
ggatcgggagttttagagtccggaaaatattccttttaa

DBGET integrated database retrieval system