KEGG   Lactobacillus buchneri CD034: LBUCD034_0091Help
Entry
LBUCD034_0091     CDS       T02244                                 

Gene name
dapE2
Definition
acetylornithine deacetylase / succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBUCD034_0091 (dapE2)
  Amino acid metabolism
   00300 Lysine biosynthesis
    LBUCD034_0091 (dapE2)
Enzymes [BR:lbn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LBUCD034_0091 (dapE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
101597..102745
Genome map
AA seq 382 aa AA seqDB search
MEKEEQLQILKDLIQIKSVNSNEVEVAEYIGKLFQKHHISYKIDKFGEDRANLVAEIGSG
KMDEVLGFTGHQDTVSVEDPSAWKHDPFKAEIDGDKLFGRGAADMKSGLAAQVITLIDLV
DEGIEIDGKIRFIATAGEEYGTPGANRLNEQGVANDLSALVVGEPTNGQVIYAHSGSLNY
QIKSIGKAVHSSRPAEGINAITGLSKYIDAEATLFNDAPKDKILGQLQHSITLIKGGEQV
NIIPDYAELYGNIRPTESFDNDQVISTIKNEVAKINKDTEFHLEFHLVHNFRPVETEPDN
PFITLVDQAAKDNYQDRDVELQTINAATDASVFITSNPKLPVVILGADESGVAHQTDEYT
TLTSYYETVETYESIAKTYFKQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaagagcagttacagattctcaaagatttgattcaaattaagtcagtcaat
agtaatgaggtggaagttgctgagtatattgggaaactatttcagaaacaccatattagt
tacaagattgacaaatttggagaagatcgtgccaatttggttgcggagattggctctggt
aaaatggatgaagtattgggatttaccgggcatcaagatacagtaagtgtggaagacccc
agtgcgtggaaacatgatccattcaaggctgagatagatggcgataaactatttggtcgt
ggtgctgcagacatgaaaagtggcttggctgctcaggtcattacattgatcgatcttgtt
gacgaaggcatcgaaattgacggcaagattcgatttattgccactgcaggagaagaatat
ggaacccccggcgctaatcggttaaatgaacagggagtggcaaatgatttgtctgcccta
gttgttggggagccaactaacggtcaggtgatctatgcacattctggcagtttgaactac
caaattaagagtattggaaaagcagttcacagttcaagacctgctgagggtattaatgcg
ataacaggtttatctaaatatattgatgccgaggcaacattatttaatgatgctcccaaa
gacaagatcttgggccaattgcagcatagcattaccctgatcaaaggtggagaacaagtt
aatatcatccctgactatgctgagttgtatggaaatattcggccaacggaaagctttgat
aatgaccaggtaattagcacaattaagaatgaagttgctaagattaataaagataccgag
tttcacttggaatttcatttggttcacaatttcaggccagttgaaactgaaccagataat
ccgtttattacccttgttgatcaggccgctaaggataactaccaagatcgtgatgttgaa
ctgcaaacaattaatgccgcaacggacgctagcgtctttatcacaagtaatcctaagttg
ccggtcgtaattttgggcgcggatgaaagtggtgttgctcatcagaccgatgaatataca
actctgacaagttactacgaaacggttgaaacttatgagtcgatcgcaaaaacatacttt
aaacagtaa

DBGET integrated database retrieval system