KEGG   Lactobacillus buchneri CD034: LBUCD034_0203Help
Entry
LBUCD034_0203     CDS       T02244                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LBUCD034_0203
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LBUCD034_0203
Enzymes [BR:lbn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LBUCD034_0203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
226406..227551
Genome map
AA seq 381 aa AA seqDB search
MVHKSWLLLPLTVLLMGCSAHKTTTAQTTSSTASEQDGKYNGVTLDVARRHYQVGTLQKF
IQLVGDHNGRFIQLHLSDDRNFAIENDYVGQSLKNAQKVDGVWHNKKTHQFFYSKAEIKY
LVNDAEQHHVTLIPEIDTPAHVTALVKLMKANGKAQLAKQVSWYSKSYRDEIHLNQTGID
FTKKLDDEVGALFAGQANPRFHLGGDEFSDKLTSNAAYVKYLNATSANVEKMGFTPEAWN
DGFLNSSLSKLNKNIQVTYWNWTADQTGKLAAERHKYWASMPKLISRGFKVFNYNDYYLY
FNLSKTNMSKKNVAYMIKDMKQYWKPTLWHNDVDTKLKSKRGIVGSSVSLWADSAGSVND
QQVYAASEQFIKTFLALAESR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggtacataagagttggctgctattgccactgacggtattgttgatgggatgcagcgcg
cacaagacgaccaccgctcagacgacttcgagcacggcgagtgaacaggatggcaaatat
aacggagtgaccttagacgttgcccgacgccactaccaagttgggacgttgcaaaagttc
attcaattagtgggggatcataacggtcggtttattcagctgcacttaagcgatgaccgg
aattttgcgattgaaaatgactacgttggtcagtccttgaagaatgcccagaaggttgat
ggggtttggcataacaaaaagacccaccagttcttttacagcaaggccgaaatcaagtat
ttggtcaacgacgccgaacagcaccacgtgacgctgatcccggaaatcgacaccccagcg
catgtgactgccttggtgaagctcatgaaggccaatggcaaggcacaactggccaagcaa
gtcagttggtactccaagagttaccgcgacgagattcacctcaatcaaaccggcattgat
ttcaccaaaaagctggacgacgaggttggcgccttgtttgccgggcaggccaatccccgc
tttcatttaggcggcgatgaattttccgataagctaaccagcaacgcggcttacgtcaaa
tatctaaacgccaccagcgccaatgtggaaaaaatgggcttcacaccggaagcttggaac
gacggctttttaaacagcagtttgagcaaactcaataaaaatatccaagtaacttactgg
aactggaccgcagatcaaaccggcaagttagctgctgagcgccacaaatactgggcctcg
atgccaaaattgatcagccgcggtttcaaagttttcaactataacgactactatctgtat
ttcaatttatccaaaaccaacatgtccaagaaaaacgtcgcttatatgattaaggatatg
aagcaatactggaaaccgacgttatggcacaacgatgttgataccaagttgaagtccaaa
cgggggattgtcggcagcagcgtatcactatgggcagactcagcgggatcggtcaatgat
cagcaggtatatgccgctagtgagcagttcatcaaaacctttttggccttggccgaaagt
agatag

DBGET integrated database retrieval system