KEGG   Lactobacillus buchneri CD034: LBUCD034_0290Help
Entry
LBUCD034_0290     CDS       T02244                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lbn00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lbn00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lbn00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321948..324173
Genome map
AA seq 741 aa AA seqDB search
MAIRIEDQNLLFHLQTDHTSYIFHVMENGELGQIYYGKRVHSKPSYDNLATREWHNAAAV
WRLDHKDVQPQVLKQEYASLGKGDFRYPAYQVAQANGSRITEFKYESYELVDGKQRLAGL
PSAFDDTDDDAQTLTIALRDKLLGLVMHLNYTIFPHQDVIIRSAEFQNQGNEKLRLNSAA
SAQLDLPDADYDFIQFSGAWARERHMIRTHLRSGVQSVGSLRGTSSHQQNPFVMLARPNT
DDAQGSVFGFNLIYSGNFSDQVQVDQYDASRVLVGINPEEFAWNLKPGDKFQTPEAVLSY
TDAGMNQLSQQMGAFYQDHLVNPRFAHEQRPTLINNWEATFMDFDEDKLLSFATTAKKLG
LEMFVLDDGWFGHRNNDDSSLGDWFVNEPKFPSGFGTFTQKIHDLGLKFGLWFEPEMISI
DSELYKQHPDWLINAPGRHASPERQQFVLDMTRSEVVDYLFDAMSKIIEMTKLDYIKWDM
NRNITETYSSQLSADDQLEVPHRYILGVYQLYDRLVKAYPDVLFESCSSGGGRFDLGMMY
YAPQAWTSDDTDAVERMLIQFGTSYGYPQTMMGAHVSAVPNDQVGRITSLKTRANVAYFG
DFGYELDITKMSPEEQQQVKEQTAFYKEHRQLFQFGKFYRIDNPFANGGNVMSWEVVSDD
QQHAIAARYQILNRPNTGYIRLYLKGLDPDTKYTVNGGSEQFYGDELMNAGLFVSDILHE
THGTDQSADFNSKLFVIDAVK
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
gtggcaattagaattgaagatcagaatctgctgtttcatttacagacggaccataccagc
tatatttttcacgtgatggaaaatggtgaactcggccagatctattatggcaaacgggtt
cactcaaagccttcatacgataatttggcaactagagagtggcataatgccgccgctgtt
tggcgacttgaccataaggatgtccagccgcaggttcttaaacaagagtatgccagcttg
gggaagggtgatttccgttacccagcctaccaagtcgcgcaagcaaatggcagccgcatt
actgaatttaagtatgagagttacgagttggtggacggtaaacaacgcttggccgggctg
ccatcggcatttgatgatacggatgacgacgcccagacgttgacgattgcactacgggat
aaattgttgggattagtgatgcatttgaactacacgatttttccccatcaagatgtcatt
atccgcagtgcagagttccagaatcagggcaatgaaaagctcaggttaaattcggcagcc
agcgctcagcttgatttaccagacgccgactacgatttcatccaattctctggtgcctgg
gcccgcgaacgccatatgattcgaacacatttacgttccggtgttcaaagtgttggcagc
ctccgcggtacttccagtcatcaacaaaatccctttgtgatgctggcacgtccgaatact
gatgatgcacagggttcagtctttggttttaatctgatttattctgggaacttttccgac
caggttcaagttgatcagtatgatgccagccgggttcttgtggggatcaacccagaagaa
ttcgcttggaatctgaagccgggcgacaaattccagactcccgaagccgttctcagttat
acggatgccgggatgaaccagttaagccagcaaatgggcgccttctaccaagatcacctg
gttaacccacgatttgcccacgagcagcggccaacgttgattaataattgggaagctacc
ttcatggactttgatgaagacaagttattaagcttcgcaaccaccgccaagaagctggga
ctggaaatgtttgtcctggatgacggctggtttggtcaccgaaacaatgacgacagctca
ttaggtgattggtttgtcaacgagccgaagttcccgagtgggtttggcacgtttacccaa
aagattcatgacttgggattgaagtttggcctgtggtttgagccggaaatgatttcaatc
gatagtgaattgtataagcaacatcccgattggttaatcaatgcacccggacgccacgca
tctccagagcgccagcagttcgtgctcgatatgactcggtccgaagtcgtcgactatctc
ttcgatgccatgagcaagatcattgagatgaccaagctggattatatcaaatgggatatg
aaccgcaatattaccgagacttacagcagtcagctcagtgctgacgaccaattagaagtg
ccgcaccgatacattctcggcgtgtaccagctctatgatcgtttggtcaaagcttatccg
gatgtcctgtttgaatcatgctcgtctggtggcggtcgcttcgacttggggatgatgtac
tatgctcctcaagcttggaccagtgatgacaccgatgcagttgagcggatgctgattcaa
tttggcacatcttatggttacccgcaaacgatgatgggcgcccatgtctcagccgtgcca
aatgatcaagtcggccggatcacttctttgaagacccgtgccaatgtggcctacttcggt
gattttggctatgagctggatatcaccaagatgtctccagaagaacagcagcaggtcaaa
gaacagactgccttctacaaggaacaccgccaactcttccagtttggaaaattctatcga
atcgataacccatttgccaatggcggtaatgtcatgagctgggaagtcgtcagcgatgat
caacagcacgcaatcgctgcgcgttaccaaattttgaatcgaccaaacaccggttacatc
cgcttgtatctcaaaggactcgaccctgacaccaagtacacggttaatggtggcagcgaa
cagttctacggcgatgagttgatgaacgctggattgtttgtaagtgacattctccatgaa
acgcacggaactgatcagtcagcggactttaattcaaagctgtttgtgattgatgccgtc
aaataa

DBGET integrated database retrieval system