KEGG   Lactobacillus buchneri CD034: LBUCD034_0308Help
Entry
LBUCD034_0308     CDS       T02244                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lbn00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lbn00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
341619..342566
Genome map
AA seq 315 aa AA seqDB search
MMQITKPVSFENVVSMEDLSAEDVLSFIHEAQDFKAGKQIELKRPVYAANLFFESSTRTH
TSFEMAERKLGLQVVNFDPSNSSLSKGESMSDTVKTFQAIGVDLVAIRDKKNEYYKDLIA
DPNVHVGIANGGDGSGQHPSQSLLDMMTIYEEFGHFEGLKVAIVGDLTHSRVARSNMEVL
TMLGAHVYFGGPKKWYTEEFAKYGEWMPIDDLVEEMDVMMFLRVQHERIADDENGAFSAE
KYHAQYGLTAERESRMPQHSIIMHPAPVNRGVEIADELVECDKSRIFEQMHNGVFVRMAI
MTSMLRNRDLIKEEY
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagattactaaaccggtaagttttgaaaatgttgtaagtatggaagacctttca
gccgaagatgttttatcatttatccatgaagcacaggatttcaaagccggcaagcagatt
gagctaaagcggccggtatacgccgctaaccttttctttgaaagcagcacaagaacccac
accagttttgaaatggcagaacgcaaattaggccttcaagttgtcaactttgatccttca
aacagttctttgagcaagggtgaatcaatgagtgacactgttaagaccttccaagcaatt
ggcgttgacttggttgccatccgtgataagaagaatgaatactacaaagatttaattgct
gatccaaacgtccatgtcggtattgccaacggtggtgacggctcaggtcaacatccatca
caatcattgcttgacatgatgactatatatgaagagtttggtcacttcgaaggtttgaaa
gttgccattgttggtgacttaacccactcgcgagttgcccgttccaacatggaagtctta
accatgcttggcgcccacgtctactttggcggaccaaagaagtggtacaccgaagaattt
gccaagtatggcgaatggatgccaatcgatgatttggttgaagaaatggacgttatgatg
ttcctccgtgttcaacacgaacgaattgctgacgacgaaaatggcgccttctccgctgaa
aagtaccatgctcaatatggtttaactgcagaacgtgaatcaagaatgccacaacattca
atcatcatgcatccagctcccgttaaccgcggtgttgaaattgccgacgaattggttgaa
tgcgacaaatcccgcatctttgaacaaatgcacaatggtgtgtttgtcagaatggcaatc
atgaccagcatgcttcgcaaccgtgacctcattaaggaagaatattaa

DBGET integrated database retrieval system