KEGG   Lactobacillus buchneri CD034: LBUCD034_0336Help
Entry
LBUCD034_0336     CDS       T02244                                 

Gene name
gpo
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
lbn00480  Glutathione metabolism
lbn00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LBUCD034_0336 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LBUCD034_0336 (gpo)
Enzymes [BR:lbn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LBUCD034_0336 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AFR99440
UniProt: J9W5B7
Position
368863..369345
Genome map
AA seq 160 aa AA seqDB search
MKTIYDYKETEMSGKTIDLSEFKNKVVVIVNTASKCGLAPQLEGLEELYKKYKNEGLVVL
GLPSNQFHQELGSDQEADDYCRIHYGVTFPMTRRVAVNGDGEDPLFTHLKEESGHGKIKW
NYTKFLVGKDGTLIHRYAPITKPESMEEAIYTALNQKNVL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaatttatgattacaaagaaaccgaaatgagcggtaagacgattgacttgagc
gaattcaaaaataaagtcgttgtgattgtgaatactgccagcaagtgtggcctggcgcct
cagttggagggcctggaagaattatataagaaatataagaatgagggcttggtcgtgtta
ggactgccttccaatcaattccaccaagagttgggaagtgatcaagaggccgatgattat
tgccggattcattatggtgtcaccttcccgatgactcgacgggttgccgttaatggggat
ggtgaggatccactgtttacccatcttaaagaagagtccggtcatggcaagattaaatgg
aactacactaaattcctggttggcaaagacggcaccctgattcatcgatatgcgccaatt
accaagccggagtccatggaagaggctatttatacggccctcaatcaaaaaaatgtcttg
taa

DBGET integrated database retrieval system