KEGG   Lactobacillus buchneri CD034: LBUCD034_0428Help
Entry
LBUCD034_0428     CDS       T02244                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lbn00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:lbn00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
464196..465524
Genome map
AA seq 442 aa AA seqDB search
MTATQIESTQDSKLVESQLSTTSEKLHNNLEVGIEKRQEIWGFGQTFNELGWQALQSLSE
EKRNEILDDLFKPGEGENYRICRIPVGASDYALNWYSLDETPGDYELKDFSIERDKKYLI
PYIKAAQKRNPDIVFSASPWSPPTWMKTKPVYNYGILKHDKKTQQAYANYFVKFIQAYET
EGIHISQLFPQNEPQRDQKFPSCYWTGEELRDFIKNYLGPTFEKAGLNTDIWLGTINSPL
EDTEMTKDETTDYPVITETVLSDPAAYRYIKGITYQWAGKSVLQRTVQAFPELNYFQSES
ECGNGNNTWTYGEYVFNLFRHYISNGVNAYMYWNSVLQDGESTWGWLQNSMISVDSKTGQ
TTYNPEYYVMKHYAHYVRPGAHLLSYGGHAAGEATAYENTDGSVIVVMSNSMNHDRDISI
DVKGKTYEAHLKEHSFNTFVFS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgactgctacacaaattgaaagtactcaagattcaaaactggttgagagtcagttgagc
accacgagtgagaagctccataataatctcgaagttggcatcgagaaacgtcaagaaatt
tggggctttggtcaaacatttaacgagttgggctggcaagcactacaaagcctatctgaa
gaaaagcgtaacgagatattggacgatttgttcaaacccggagagggtgaaaattatcga
atttgccggatccccgttggtgccagtgactatgctttgaattggtattcattagatgaa
acacctggcgattatgagttaaaggatttctccatcgagcgtgataagaaatacttaatt
ccatatatcaaagctgcccaaaaacggaatccagacatcgtcttttccgcttcaccatgg
agcccgcctacatggatgaagacaaaacccgtgtacaattatggaatcttgaaacatgat
aagaagactcaacaagcatatgcgaattactttgtaaagttcattcaggcatatgagact
gaaggaattcacattagccaactgttcccacaaaatgagcctcaacgagatcagaaattt
ccttcatgctactggactggtgaggagttacgtgacttcatcaagaattaccttgggcca
acttttgaaaaagcagggttgaataccgacatctggttaggaactatcaactcgccgctc
gaagatactgaaatgaccaaggatgaaaccaccgactatccagttattactgaaacggtt
ctttcagatcccgctgcttatcggtatattaaagggattacctatcaatgggcaggtaag
tctgtccttcaacggactgtacaagcattcccggaattgaactatttccagtcagaatct
gaatgtggtaatggtaacaatacttggacttatggggaatacgtctttaacttattccgt
cactatatcagtaatggtgtgaacgcttatatgtattggaattctgtcttacaagatggt
gaaagcacgtggggttggttacagaacagcatgatttcggttgattcaaagactggtcag
acgacctataaccctgaatattacgttatgaagcattacgcacattacgttcgaccaggt
gctcacttgctttcgtatggcggccacgctgctggggaagcaactgcttatgagaatacc
gatggtagtgtcattgtggtgatgtctaatagtatgaaccatgatcgagacatctcgatt
gatgttaagggcaaaacatacgaggctcacttaaaagaacattcattcaacacattcgtt
ttctcttaa

DBGET integrated database retrieval system