KEGG   Lactobacillus buchneri CD034: LBUCD034_0772Help
Entry
LBUCD034_0772     CDS       T02244                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBUCD034_0772 (rbsK)
Enzymes [BR:lbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LBUCD034_0772 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
799982..800899
Genome map
AA seq 305 aa AA seqDB search
MTNKVVVLGSLNVDTTLHIDQMPKPGETISAKSKTNSAGGKGANQAVAAARSGAQTSFIG
QVGDDSNGIFMIDALKLDGINTDHVGINQVDGTGSAVILLDSQGQNSIMVYGGANQAMKT
EVIADSQALIKSADILISEFETPQEVTYEAFKLAKQHGVTTILNPAPASKIIYGLLEVTD
LIVPNETESATLTGIEVNDTDSMDQNAAKFSEMGIDNLIITVGDRGAYYHTPSDSGFVPA
FKVKAKDTTAAGDTFIGAFSSQIDKDLSNIEAALVYAQKASSITVQRLGALPSIPTAEEI
KAEYK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaagtggttgtgctcggaagtctaaacgttgatacaacattgcacattgac
caaatgccaaaaccgggggaaacgattagtgccaagagtaaaaccaattccgctggcggt
aaaggggccaatcaagcagtcgcagctgcccgttccggtgctcagacgagttttattggg
caagtgggtgatgatagcaacggcatctttatgatcgatgctttgaaacttgacggcatt
aataccgatcatgtgggtatcaatcaggttgatgggaccggttctgcggtcattcttctg
gacagccagggtcaaaacagcatcatggtttatggtggggccaaccaagccatgaaaact
gaagtcattgccgacagccaagccctgattaaaagtgccgatattttaatttccgaattt
gaaacaccgcaggaagtgacctacgaagcgttcaagttggccaaacaacacggcgtgacc
acgattttaaatccggcaccggcttcaaaaatcatttacgggttgctcgaagtcaccgat
ttaattgttcccaacgaaaccgaaagtgccacattgaccggtatcgaagtcaacgatact
gattcaatggatcaaaacgccgctaaattcagcgagatgggtatcgacaacttgatcatt
actgtgggcgatcgcggcgcgtactatcatactccaagtgacagtgggtttgtgccggcg
ttcaaagttaaggcaaaagacaccacggcagctggtgacacatttattggggctttcagt
tcacaaattgacaaagatttatccaatattgaagccgctttggtttacgctcaaaaggcc
tcatccattacagttcaacgtttaggggccttaccttccattcccacggccgaagaaatc
aaagcagaatacaaataa

DBGET integrated database retrieval system