KEGG   Lactobacillus buchneri CD034: LBUCD034_1053Help
Entry
LBUCD034_1053     CDS       T02244                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LBUCD034_1053 (ruvA)
Enzymes [BR:lbn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LBUCD034_1053 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1047294..1047893
Genome map
AA seq 199 aa AA seqDB search
MFEFLEGTVVDITPTHIVLLVGGVGYLINTADPYRFNVDEKKVIRVYIYQSVSDTAILLF
GFATIEDKQIFEKLISVSGIGPKSALAILAGNDRDGLITAINNEDVKFLTKFPGVGKKTA
RQIILDMQGKLDDIATNGASLAQPLGSPEKSPELADALSALEALGYGAKQIAAIEPDLVK
QADLSTDEYLSLGLKLLMH
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatttttggaagggacggttgttgatatcacacccacccacatcgttttatta
gtgggcggcgttggttatttgatcaataccgcagacccgtaccgttttaatgttgatgag
aaaaaagtcatcagagtctatatttatcagtcagtgagcgatacggctatcttgctgttt
ggctttgcgaccattgaagacaagcagatctttgaaaagttgatttcggtttccgggatt
ggccccaaaagtgctttggcaattttggccggcaacgaccgggatggattgatcaccgca
attaataatgaagacgtcaagtttttgacgaagttccccggagttggtaagaaaactgcc
cgccagattattttggacatgcagggaaagctcgacgacattgcaactaatggtgcttcg
ctggcccaaccgcttggcagtcccgaaaagtctcctgaattggccgatgcgttatcggca
ttggaggcgctgggttatggtgccaaacagattgccgccatcgagccggatttagttaag
caagctgatttgtcaaccgatgaatacttaagtttaggattgaaactgttaatgcattag

  All links  
No link information was found.   
DBGET integrated database retrieval system