KEGG   Lactobacillus buchneri CD034: LBUCD034_1185Help
Entry
LBUCD034_1185     CDS       T02244                                 

Gene name
dfrA
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LBUCD034_1185 (dfrA)
   00670 One carbon pool by folate
    LBUCD034_1185 (dfrA)
Enzymes [BR:lbn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LBUCD034_1185 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1177894..1178379
Genome map
AA seq 161 aa AA seqDB search
MLAFIWAEDANGLIGANGQLPWHLPDDMHYFKETTMGNTIISGSKTFRSYNRPLPGRENI
VVSHQTDFPTGVKVIPSIEQLCDLIAQNPDKQYIVTGGANLFAQLRSKVDRLYRTKIEAE
FSGDTYMPAIDYSLFELSKSVVGVVDGKNKYPHTFEVFDRK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgctagcttttatctgggctgaagacgccaacggcttaattggtgccaatggccaactt
ccttggcatctgccggacgatatgcattacttcaaagaaaccacgatgggcaatacgatt
atttccggatcgaaaaccttccgcagttataatcggccactgccgggtcgtgagaatatt
gtggtttcacaccaaactgattttccaacgggcgtcaaagttatcccttcgattgaacaa
ctgtgtgacttgattgctcaaaatcccgataaacaatatattgtgaccggaggtgccaat
ctatttgcccaattacgttcaaaagtcgaccggctttatcgcacgaagattgaagctgaa
ttttccggtgacacctatatgccagccattgactattctttatttgaattgagcaaatcg
gtcgttggtgttgttgacggcaaaaataagtacccccacacttttgaagttttcgataga
aaataa

DBGET integrated database retrieval system