KEGG   Lactobacillus buchneri CD034: LBUCD034_1197Help
Entry
LBUCD034_1197     CDS       T02244                                 

Gene name
glpk3
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBUCD034_1197 (glpk3)
Enzymes [BR:lbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LBUCD034_1197 (glpk3)
Exosome [BR:lbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBUCD034_1197 (glpk3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1190352..1191860
Genome map
AA seq 502 aa AA seqDB search
MNDQQYIMSIDEGTTSTRAILFNNDGDIVGKAQREFHQYFPKSGWVEHDANEIWNAVQSV
ISEALINADVQPYKVRGIGVTNQRETTVIWDKNTGEPIYHAIVWQSKQTAALADQLKHDG
YDDMIHEKTGLIIDSYFSATKIQWILDHVDGARQKAENGDLLFGTIDTWVLWKLTGGKVH
ATDYTNASRTMLFNIHTLTWDKDILDLLHIPESMLPEVRSSSEIYGYTAGYSFSGVQVPI
AGIAGDQQAALFGQMALQRGMIKNTYGTGAFIVMNTGEEPTLSKRGLLTTIAYGINGKVN
YALEGSIFVAGSAIQWLRDGMEMVKSSPDSEQMAIDAKSTDGVYVVPAFTGLGAPYWDQD
ARGAVFGLTRGTTKNQFVRATLESLAYQTRDVVDTMAAETGIDLKSLAVDGGAANNNYLM
QFQADILGTPIQRASISETTALGAAYLAGLAVGFWDSIEEIRRTVKSRDAFEPQMDEQTR
TKLYTGWQKAVQATIQYHPDEN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcagcaatacataatgtccattgatgaggggacaacaagtacccgggcaata
ttgtttaataatgatggtgatatcgttggtaaagcacaacgggagttccaccagtatttt
ccaaaatccggttgggttgaacacgatgccaatgagatttggaatgccgttcaatcagtg
atctcagaagccttgattaatgcggatgtccaaccatacaaggttcggggaattggtgtg
accaaccagcgggaaaccacggtcatttgggataaaaataccggcgagccgatttatcat
gccattgtttggcagtccaaacaaaccgctgccttagccgatcagctcaagcacgacggt
tatgatgatatgatccatgaaaaaaccggcttgatcattgattcctacttttccgcaact
aagattcaatggattttggatcatgtagacggcgctcgccaaaaggccgaaaatggcgat
ttattgtttggaaccattgatacctgggtcctttggaagctgaccggcggcaaggttcat
gcgaccgattataccaatgccagtcggacgatgctgtttaacattcacacgttgacttgg
gacaaagatattttggacctgctgcacattcctgaaagcatgctgccggaagtccgttcc
tcgtcagaaatttatggttatacagctggttattccttctcgggtgttcaggttccgatt
gctggaattgccggtgaccaacaagcagctttgtttggtcaaatggctctgcagcgcggg
atgatcaaaaacacttacggaaccggtgcctttatcgtcatgaatactggtgaggagccg
acactttccaaacgggggctgttgacgaccattgcttatggaatcaatggcaaagttaat
tatgccttggaaggaagtattttcgtcgctggttctgccattcaatggcttcgagacgga
atggaaatggttaagtcatcccctgactcggaacaaatggcgattgatgctaaaagtacc
gatggcgtctacgtcgtaccagcctttaccgggttgggtgcgccctactgggatcaggat
gccagaggggcggtctttggcctgactcgtggcacgaccaaaaatcagtttgttcgagct
acgcttgagtcattagcttatcaaaccagggatgttgttgacaccatggcagctgaaacc
ggaatcgatttgaagtcgctggcagttgacggaggggcagctaataacaattatctcatg
caattccaagctgatattttgggaacgccaattcagcgggcctcaatttcagaaaccacc
gcgctgggtgcagcctacctagcaggcttggcagtcggcttttgggattctatcgaagaa
attcgccggaccgttaaatcacgggatgcttttgaaccgcaaatggacgagcagacacgc
acaaaactgtataccggttggcaaaaggccgtccaggcaacgattcagtatcatcccgac
gaaaactaa

DBGET integrated database retrieval system