KEGG   Lactobacillus buchneri CD034: LBUCD034_1230Help
Entry
LBUCD034_1230     CDS       T02244                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lbn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1227442..1228293
Genome map
AA seq 283 aa AA seqDB search
MTNSNEVHFKGKNFDFNLTETPIIYSILNLTPDSFYDGGVNTSIDQVLDRIETEMGYGAK
TFELGGKSSKPHFDDISPDEEWQRVEPYLKAIQKRFPNIVLAIDSNTNSVIERALQSGIQ
IINDIDGFNSQAKLDLVQQYQPSVVTMFNGRNFDEQPTTLEDTMHSFFTGSINRLEQAGL
QRENIVIDPGVGFSDRNTLEFDLIKMRYTKQMRQFGAPIMIAISQKSFAKRLFDAGSDER
LIPTLLFEAYMTQLGGRIIRVHNVKETQELIKTYQIFKDILSD
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgactaattctaatgaagtccatttcaaagggaagaattttgatttcaatctgactgaa
acgccgattatctattccattctcaatttaaccccggattcattttacgatggtggggtc
aataccagtattgatcaagttttggaccgcatcgaaactgaaatgggctatggtgccaaa
accttcgaactgggtggcaaatcgtccaagccccattttgatgatattagtcccgatgaa
gagtggcagcgggtagaaccctatcttaaagcgattcaaaagcggtttccaaatattgta
ttggcaatcgattcgaataccaactcagtgattgaacgggcgttgcaatctggaattcag
atcattaatgatattgatggctttaattctcaagccaaactggatttggttcaacaatat
caaccctcagtcgtcacgatgtttaatggtcgcaattttgacgaacaaccaacgacactt
gaagacacgatgcattcatttttcacaggctcgattaaccgtttagaacaagctggtctt
caaagggagaacattgttattgatcccggggttggcttctctgatcgcaatacactggaa
tttgatttgattaaaatgcgttacacaaaacagatgcgccagtttggagcgccgatcatg
atcgcaatttctcagaaaagttttgccaaacggctgtttgatgcaggctcagatgagcgg
ctgatcccaacattactgtttgaagcttacatgacccaacttggtgggcgaattatccga
gtccataacgtcaaagaaacccaagaattaattaaaacgtatcagatcttcaaggacatt
ttaagtgattaa

DBGET integrated database retrieval system