KEGG   Lactobacillus buchneri CD034: LBUCD034_1300Help
Entry
LBUCD034_1300     CDS       T02244                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
lbn00010  Glycolysis / Gluconeogenesis
lbn00052  Galactose metabolism
lbn00500  Starch and sucrose metabolism
lbn00520  Amino sugar and nucleotide sugar metabolism
lbn00521  Streptomycin biosynthesis
lbn01100  Metabolic pathways
lbn01110  Biosynthesis of secondary metabolites
lbn01120  Microbial metabolism in diverse environments
lbn01130  Biosynthesis of antibiotics
lbn01200  Carbon metabolism
Module
lbn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBUCD034_1300 (glcK)
   00052 Galactose metabolism
    LBUCD034_1300 (glcK)
   00500 Starch and sucrose metabolism
    LBUCD034_1300 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LBUCD034_1300 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LBUCD034_1300 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LBUCD034_1300 (glcK)
Enzymes [BR:lbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LBUCD034_1300 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFS00338
UniProt: J9W1D1
Position
complement(1293100..1294119)
Genome map
AA seq 339 aa AA seqDB search
MKKNKKVGENTLAKKLIGIDLGGTTVKFAFIDTKGNVLTKWRIPTNISEHGSHIVPDMIK
SISDQMRKDDYNASDFYGIGMGTPGAVNREKGTVVGAYNLNWDIVQPVGATISANLNLPI
LIDNDANSAALGEYWKGAGDKAKDVVFITLGTGVGGGVIANGKLVHGINGGAGEVGHITV
VPNGYQCTCGKRGCLEQYASATGVVHIAKDMAKKFTGHSRIKELIDGDEDLSSKMVFFLA
DNGDILANQIVDRVCSYLGLALSHIGNTLNPENIIIGGGVSNAGNTLLQPTTRYFQENAF
PSVRDSTRLKLAQLGNDAGIIGAASLALQFRNNQPFGTK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaaacaagaaagtaggggaaaatacattggctaagaaattaatcggaattgat
ttgggtggaacgacagttaaatttgcattcattgatacaaaaggaaacgtcctgacgaag
tggcgaatcccaaccaacattagtgaacacggcagtcacattgtgcctgacatgatcaaa
tcaattagtgatcaaatgagaaaagacgactataacgcaagtgatttttatggtatcggc
atgggaactcccggtgctgtgaaccgcgaaaagggaacagttgttggagcatataacttg
aactgggacatcgtgcaaccggttggagcaaccatttcagccaatctcaatttaccaatt
ctgatcgacaacgatgcgaatagcgccgctcttggtgaatattggaaaggtgccggcgac
aaagcaaaagatgtcgtcttcattactttaggaactggcgttggcggtggtgttatcgcc
aatggcaagctggttcatggtattaacggtggtgccggagaagtcggtcatatcacggtt
gtccctaatggatatcaatgtacctgtggaaagcgcggctgtttggaacagtacgcttca
gcaaccggggttgtccatattgctaaagatatggccaagaagtttaccggccattcacgg
attaaagaattgattgatggcgacgaagatttgtcatcgaagatggtcttcttcctagct
gataacggtgatatcttggcgaaccaaattgttgatcgggtctgctcatacttgggattg
gcactttcacacattggtaacacgttgaacccggagaacatcattattggaggcggtgtt
tccaacgccggtaacaccttgcttcagccaacgactcgttatttccaagagaacgccttt
ccttctgttcgtgactcaacacggttgaagttggctcaactcggtaatgacgccggaatt
attggtgccgcatcattagccttgcaatttagaaataatcaaccatttggaaccaaataa

DBGET integrated database retrieval system