KEGG   Lactobacillus buchneri CD034: LBUCD034_1441Help
Entry
LBUCD034_1441     CDS       T02244                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lbn  Lactobacillus buchneri CD034
Brite
Enzymes [BR:lbn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LBUCD034_1441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1429418..1430173)
Genome map
AA seq 251 aa AA seqDB search
MGAMQTPVKSFYFEHGPRAIILLHAFASGPVDVRMLARYLERQNYTVYAPMFTGHGTADF
TDILIQGTPERWWNDAKRAVQFLKDKGYDQISIFGISLGGIFAAKTLENDPTLLGGGSFG
SPIVRKRQFSVHNTFMQMAKANFVQYDTNEAIMNSKLKWLDENIDILLGKIADFTVGVAQ
DLPKITQPYFIGQGLSDEIVNPESAKSLRDGLVNSRVSYHEYPNASHMITVNPAHKQLEA
DLTEFLTQLYE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctatgcaaacaccagtcaaatctttttattttgaacacggaccgagagcaatt
attctgttgcatgcttttgccagtggcccggttgacgttcgaatgctcgcgaggtatttg
gagcgtcagaattataccgtgtatgcgccaatgtttacgggccatgggacggctgatttt
accgatatcctgattcagggaacgcccgagcgttggtggaatgatgccaaacgggccgtc
cagtttctaaaggacaagggctatgaccaaatcagtatctttggcatctcgctgggcggt
atttttgccgctaaaacgctggagaatgatccgactttactcggcggcggttcgtttgga
tcaccaattgttcgaaagcgtcagtttagtgttcataatacctttatgcaaatggccaaa
gccaattttgttcagtatgataccaatgaagcgattatgaattcaaaactcaagtggctt
gacgaaaatattgatatactattaggtaagattgctgatttcacagttggtgtggcgcag
gatctacctaaaatcacccaaccatacttcatcggtcaggggttaagcgatgagatcgtg
aatcctgaaagtgccaagtctttgagggatggattggtgaacagtcgggtcagttaccac
gaataccccaacgccagtcacatgattaccgttaatcctgctcacaagcagcttgaggct
gatttaaccgaatttttaacacaactttatgaataa

DBGET integrated database retrieval system