KEGG   Lactobacillus buchneri CD034: LBUCD034_1446Help
Entry
LBUCD034_1446     CDS       T02244                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBUCD034_1446 (tpiA)
   01230 Biosynthesis of amino acids
    LBUCD034_1446 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBUCD034_1446 (tpiA)
   00051 Fructose and mannose metabolism
    LBUCD034_1446 (tpiA)
   00562 Inositol phosphate metabolism
    LBUCD034_1446 (tpiA)
Enzymes [BR:lbn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LBUCD034_1446 (tpiA)
Exosome [BR:lbn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LBUCD034_1446 (tpiA)
  Exosomal proteins of bladder cancer cells
   LBUCD034_1446 (tpiA)
  Exosomal proteins of melanoma cells
   LBUCD034_1446 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1435694..1436452)
Genome map
AA seq 252 aa AA seqDB search
MRIPFVAGNWKMNLSVAEAVKFLQAIEGELPDPKITETCIAASPLFLESMVEENGDSPLI
ISAENCFYEDEGAYTGETSPKALAEMGVTHVIIGHSERRKYFNETDDIINKKVHAAFRNQ
LTPIICCDETMSRRESADRISWVVSQVTNALKSITPQQAEKIIVAYEPSWAIGSGKTASS
DEAEEGCYLIRQTIADLYGDDIADQVRVLYGGSVNDENADDILSQTDIDGVLAGGASLKP
DSFLKLANFLQK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaattccgttcgttgcgggtaactggaaaatgaatttatcagtcgctgaagcagtc
aaatttcttcaagccatcgagggtgaattacccgatcctaagataaccgagacctgtatt
gcggcttcaccactctttttggagagcatggtcgaagaaaatggtgattcaccactgatt
atctccgctgaaaattgtttttatgaagacgagggcgcatacaccggggagactagcccc
aaagcgcttgccgaaatgggcgtgacccacgttattattggtcattcagagcgtcgtaag
tactttaacgaaaccgacgacattattaataaaaaggttcacgctgcttttcgcaaccaa
ttaacaccaatcatctgctgtgatgaaacgatgagccggcgtgaatccgctgatcgaatt
tcctgggtggtcagtcaagtgaccaacgcccttaaatcgattaccccgcaacaagctgag
aagatcattgttgcttacgaacccagttgggcaatcggcagcggcaaaaccgccagcagc
gatgaagccgaagagggttgttatttaattcgtcaaaccattgctgatttgtatggcgat
gatattgccgatcaagtccgagtcttgtatggcggcagtgtaaacgacgaaaacgccgat
gacattctgtcacagactgatatcgacggtgttttggccggtggtgccagcttaaaaccg
gattcattcttaaagcttgcaaactttttacaaaaatag

DBGET integrated database retrieval system