KEGG   Lactobacillus buchneri CD034: LBUCD034_1453Help
Entry
LBUCD034_1453     CDS       T02244                                 

Gene name
adh2
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
lbn00010  Glycolysis / Gluconeogenesis
lbn00071  Fatty acid degradation
lbn00350  Tyrosine metabolism
lbn00625  Chloroalkane and chloroalkene degradation
lbn00626  Naphthalene degradation
lbn01100  Metabolic pathways
lbn01110  Biosynthesis of secondary metabolites
lbn01120  Microbial metabolism in diverse environments
lbn01130  Biosynthesis of antibiotics
lbn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBUCD034_1453 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    LBUCD034_1453 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LBUCD034_1453 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LBUCD034_1453 (adh2)
   00626 Naphthalene degradation
    LBUCD034_1453 (adh2)
Enzymes [BR:lbn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LBUCD034_1453 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AFS00482
UniProt: J9W4C4
Position
1442030..1443106
Genome map
AA seq 358 aa AA seqDB search
MDVNQTKEQVKQTADESIPTEMKAWEIVKPGSINGAVSPLRYTTKPVPKPKRGEVLVKVI
ACGVCHTDLHVTEGDLPVHKEHLTPGHEIVGRVVQMGAETRRFKLGDRIGIPWLRWTCGV
CEYCRSGRENLCPNSLYTGWDHDGGYAEYVTVPEGFAYRIPARFDSLTAAPLLCAGIIGY
RAYERANVPAGGTLGLYGFGGSAHLTAQIAMKQGIEVHVLTRGEDARKFALQLGAASARG
TYDMPPVKLDSAINYTPVGDVVPKAMEALKPGGTLAMAGIHSTDIPQMSYPSHIFHEKNL
TSVESNTRRDGEEFLTLADRLNIHPEVTEYPLAKADEALKYIAKGDIRGACVLRVSEG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcaatcaaacaaaagaacaagttaaacaaactgctgatgaatcaatccctact
gagatgaaggcctgggaaattgttaagcccggttcaattaacggtgcggtttctccttta
cgttacaccaccaagccggtgccaaaaccaaaacgaggcgaagttttggtcaaggtcatc
gcttgcggggtctgccacacggatctccatgtaactgaaggcgatctgccggttcataag
gaacatttgacgcccggtcatgaaatcgttggtcgggtcgttcagatgggtgctgaaacc
cgtcgatttaaattaggcgatcggattgggattccttggttacgttggacttgcggggtt
tgtgaatattgccggtccgggagagaaaatctctgccccaactcactttataccggctgg
gatcatgatggcggctatgcagaatacgtcactgttccggaaggtttcgcataccggatt
ccggcccggtttgattcactgacggctgccccactgctttgcgccggaatcatcggctat
cgggcatatgaacgggctaacgtccctgcaggcggcaccttgggcctgtatggcttcggc
ggctcggctcatttgaccgcccaaattgcaatgaagcaaggcatcgaggttcacgtttta
acccgtggtgaagatgccaggaaatttgccctgcaactgggagctgcctcagccagagga
acctatgatatgccacccgttaagctggattcggcaatcaactacacaccggttggtgac
gtagttccaaaagccatggaagcgctgaaaccaggtggcacgttggcaatggccggtatc
cactcaacagatattccgcaaatgagttatccaagtcacattttccatgaaaaaaatctc
accagtgtcgaaagcaacacccgtcgggatggtgaagagttcctgaccttagctgatcga
ctcaatatccatccggaggtcactgaatatccgttggccaaagctgacgaggcgctgaaa
tatattgccaaaggtgatattcgtggtgcctgtgttttaagagttagtgagggctaa

DBGET integrated database retrieval system