KEGG   Lactobacillus buchneri CD034: LBUCD034_1461Help
Entry
LBUCD034_1461     CDS       T02244                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
lbn00040  Pentose and glucuronate interconversions
lbn00052  Galactose metabolism
lbn00500  Starch and sucrose metabolism
lbn00520  Amino sugar and nucleotide sugar metabolism
lbn01100  Metabolic pathways
lbn01130  Biosynthesis of antibiotics
Module
lbn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LBUCD034_1461 (galU)
   00052 Galactose metabolism
    LBUCD034_1461 (galU)
   00500 Starch and sucrose metabolism
    LBUCD034_1461 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LBUCD034_1461 (galU)
Enzymes [BR:lbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LBUCD034_1461 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AFS00490
UniProt: J9W6B0
Position
complement(1453070..1453966)
Genome map
AA seq 298 aa AA seqDB search
MTRKVTKAVIPAAGLGTRFLPETKALPKEMLPIVDTPTIQFIVEEAKQAGIKDIVIVIGK
GKRSIEDHFDSNPELEMNLEERHKNDILETIRKTNDMNIYFIRQSHPRGLGDAIYTARSF
ISNEPFVVMLGDDVMQDKVPLTKQLMESYQQTGASTLAVKKVAHKDISKYGVIDPSEEVR
PGLFNVKKFVEKPTPEKAPSDLAIIGRYLLTPEIFGILENAKPDKTGEIQLTSAIDTLNQ
TQRVFAHEFKGERFDTGNKLSWLKTNIIFGLRHPEISDGLRTYLKDLGAQLTEEDKKK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccagaaaagtaaccaaagcagtcattccggctgccggcttaggaaccagattttta
ccggaaaccaaggcactcccaaaggaaatgctaccgattgttgatacaccgacaattcaa
tttattgttgaagaagccaaacaggcgggcatcaaagacattgtaattgtcatcggtaaa
ggcaagcgctcaatcgaagatcactttgactcgaatcccgagttggaaatgaatttggaa
gagcgccacaagaacgatattcttgaaaccattcgcaagaccaacgacatgaatatttac
ttcattcgtcagtctcatccccgtgggttgggtgatgcaatttacaccgcccgcagtttc
attagcaatgaaccgtttgtggtcatgcttggtgatgacgtgatgcaggacaaagtgcca
ctgaccaaacaattaatggaaagctatcagcagactggagcttccacattagcagtgaag
aaagttgcccacaaagatatctccaaatatggggtcattgatccctctgaagaggtccgc
ccaggcttgttcaacgttaaaaagttcgttgaaaagccaacgccagagaaggcccccagc
gatttagcgattattggccgctacttgttgacgcccgaaatcttcggcattttggaaaac
gccaaaccggataaaactggtgaaattcaactgacatctgcaattgacaccttgaaccag
acacagcgggtctttgctcatgaatttaagggtgaacgattcgatactgggaacaaatta
agctggctcaaaaccaacatcatctttggtctgcgccatccagaaatttctgatggcttg
cgaacttatctcaaagatttgggcgcccaattaactgaagaagacaaaaagaagtaa

DBGET integrated database retrieval system