KEGG   Lactobacillus buchneri CD034: LBUCD034_1503Help
Entry
LBUCD034_1503     CDS       T02244                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LBUCD034_1503 (recR)
DNA repair and recombination proteins [BR:lbn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LBUCD034_1503 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1491893..1492492)
Genome map
AA seq 199 aa AA seqDB search
MQYPEAIAKLIDSYMKLPGIGSKTATRLAFYTVDMNEDDVKAFSKALVATKNDLHYCSIC
GNLTDEDPCEICRDKTRDQSTILVVEEPKDVMVMEKVQEYHGLYHVLHGVLSPIEGKGPE
DLNISSLIKRLQQNKAVKEVIVATNATPEGEATAMYLSKLIKPAGIKVTRLAHGLSVGSD
IEYADEVTLFKAVQGRTEI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatcctgaagcaattgcaaagttaattgatagttatatgaagttaccgggaatc
gggagtaagacagctaccagacttgctttttacaccgtcgatatgaatgaagatgatgtc
aaagcgttttcaaaggcgctggttgccaccaagaacgaccttcattactgttcgatttgt
ggtaatctaaccgatgaagatccctgtgaaatttgtcgtgataaaacccgtgatcaatca
accatcctagtggtggaagaacccaaagacgtgatggtaatggaaaaggtccaggagtac
cacggcctttatcatgttttgcatggggtactgtcaccaattgaaggcaaaggacctgaa
gatcttaatatcagctcactgatcaaacgactccagcaaaataaagccgttaaagaagtg
attgtggccaccaatgccaccccagaaggcgaagcaactgcaatgtacttgagcaagttg
attaaacccgctgggatcaaagtgactcgtttggctcacggattatcagttggatcagat
atcgaatatgctgatgaagtcacgttgtttaaggcagtccaaggacggactgaaatttaa

DBGET integrated database retrieval system