KEGG   Lactobacillus buchneri CD034: LBUCD034_1926Help
Entry
LBUCD034_1926     CDS       T02244                                 

Gene name
gmk3
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lbn00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1898304..1898858)
Genome map
AA seq 184 aa AA seqDB search
MKNRVFVITGAAGSGKTTVRDYLHDQYQMARVITHTTRPPRENERDGVDYYFEDDQSFFD
NHFLESVHYAGHYYGSSYEGLENAWEKSPFATIVLDTAGAITYKQKLGEKAIIIFLQVGD
TEELKRRMQGRGDNAEMVAKRVSSKEYHRDLEMPHELQGKAYQVVNQDWQQTRQQIDKIV
ENYR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcgagtatttgtgatcaccggagccgctggcagtggcaagacaaccgttcgt
gattatttacatgaccaatatcaaatggcccgggtgatcacccacaccacccggccgccg
cgggagaatgaacgtgacggggtggactattattttgaggacgaccaatcgttctttgac
aatcactttttggagtccgtccactatgccggccactattatggttcatcttacgaaggc
ttagagaatgcctgggagaaatcaccgtttgcgacgattgtcctggatactgccggagcc
attacatataagcagaaactgggcgaaaaagcgatcatcatttttctgcaggtcggcgat
accgaagaactcaaacgccgaatgcagggacgtggtgacaatgctgagatggttgctaaa
cgggtcagcagtaaggaataccaccgggatctcgaaatgcctcatgaactgcagggcaag
gcttatcaagtggttaaccaggattggcagcagacgcgtcaacaaattgacaaaatcgtt
gagaattatcgttaa

DBGET integrated database retrieval system