KEGG   Lactobacillus buchneri CD034: LBUCD034_1942Help
Entry
LBUCD034_1942     CDS       T02244                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lbn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1918978..1920456
Genome map
AA seq 492 aa AA seqDB search
MKLNNQAMLITYPDSLGNNIKDLQKVLSTYLDGVVGGVHLLPFFPSSGDRGFAPMDYTKV
DEKFGNWDDVKKLSESYYLMFDFMVNHISKQSKYFKDFQANHNQSAYRDLFIHWNEFWPK
GRPTQEDIDLIYKRKPKAPVQTVKFADGQTEDVWNTFGEDQIDLNVNSKVTKQFIKDTLN
FLMDHGASIIRLDAFAYAIKKLGTNDFFVEPEIWDLLKEISDITNPRETTLLPEIHENYH
IVRKITDHDYFSYDFALPIVTLYSLYSGKADRLAGWLKNSPMKQFTTLDTHDGIGVVDAK
DILSDDELDYTKAEMYKVGANVKKVYSSTAYHNLDVYQINTTYYSALGDNDHAYLLARAI
QVFAPGIPQVYYVGLLAGKNDLGLLEKTKEGRNINRHYYSLDEVAEETKRPVVKALFDLL
RFRNQSSAFDLEGGIDVQQNGDNEIVVTRRSEDGQTSATLSANLQTQAFTITETNSDGET
KEILTSNLSAVK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaacaatcaagcaatgctcattacctatcccgatagtttgggaaataatatc
aaagatttgcaaaaagtcttgtcaacatacctggacggtgtcgttggtggtgttcacctg
ctgccattcttcccgtcatctggtgatcgcggtttcgcaccgatggattataccaaagtg
gacgaaaagtttggcaattgggacgacgtgaaaaagctgtccgagtcatactatttaatg
tttgacttcatggtcaaccatatttcaaaacaatccaaatactttaaagatttccaagct
aaccacaatcagtctgcttatcgggatctgttcatccactggaatgaattttggcccaag
ggtcgtccaactcaagaagatattgatttaatttataagcgcaagccaaaggcccctgtt
caaacggttaaatttgccgacggtcagaccgaagatgtctggaacacctttggtgaagat
cagatcgatctgaatgtgaattccaaggtaaccaaacagttcatcaaagataccttgaac
ttcttgatggaccatggtgcttctatcattcgcctggacgccttcgcttacgctatcaag
aaactcggcaccaacgatttcttcgtagaaccggaaatttgggatctactgaaagaaatc
agtgacatcactaatccacgtgagaccactttattgcccgagatccatgaaaactaccat
attgtccgaaagattaccgaccatgattacttcagttatgactttgccttaccaattgta
actttgtacagtttgtactcaggtaaggctgatcgcttggccggctggcttaagaacagt
ccgatgaaacagttcacgactttggatacccacgatggcattggggttgtggatgccaaa
gatattctatcggacgacgaactggattacaccaaagctgaaatgtataaagtcggcgcc
aacgtcaaaaaagtgtattccagtactgcttaccataaccttgacgtttaccagatcaat
accacttactactcggctctgggggataacgatcacgcttatctgcttgcccgtgccatt
caagtctttgcaccagggattcctcaggtttactatgtcggcctgcttgccggtaagaac
gatctgggcttgctggaaaagaccaaggaaggccgcaatatcaaccgtcactattactca
ttggatgaagtagctgaagaaactaaacggccagtcgtcaaagcattgtttgatctcctc
cgcttccgtaatcagagctcggcgtttgatttggaaggtggaattgatgtccaacagaat
ggtgacaatgaaatcgtggttacccgccgatccgaagatggtcagacttccgcaactttg
tccgctaacttgcagacccaagcctttaccattaccgaaaccaattccgatggtgagact
aaggaaatattaaccagtaatttgtcagccgttaaataa

DBGET integrated database retrieval system