KEGG   Lactobacillus buchneri CD034: LBUCD034_2113Help
Entry
LBUCD034_2113     CDS       T02244                                 

Definition
ROK_glcA family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:lbn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lbn00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lbn00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lbn00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lbn00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:lbn00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2108863..2109828)
Genome map
AA seq 321 aa AA seqDB search
MTKYYLGVDLGGTNIKAGLFDEDFQTVQKLHKPTHEEAGPTEVLNRIWACCQQLMAQEKI
TSDDILAAGFGIPGQMDVEKGISIFSPNFTDWKDVPVAKWLQDKLGQPVFIDNDVRVNLY
GEMAFGAGRGHRNVVLVTIGTGLGAAVLINGQVLYGASNSVGEIGHMNMYRHGRPCACGS
TGCLGRYVSARGIVKTMQEKLADGQTSLVGEWMSQGQELTTKLISKAVAKGDPTAVEVFK
ETGELLGFGLGNVINLFNPETLILGGGVSAAGEPLFKYTRETLAHHSLPVAREACKLETA
QLGDEAGMVGAAVYAGQKVRA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatattatttgggtgttgatcttggcgggaccaacattaaggccggactgttc
gatgaggattttcaaacggtccaaaaattacataagccgactcatgaagaggccggtcct
actgaagtactgaatcggatctgggcgtgctgccagcaattaatggctcaggaaaagatt
acctcagatgatattttggctgccggttttggcattcccgggcaaatggatgtggaaaag
gggatttcaattttttcaccgaattttaccgattggaaggatgtcccggtcgccaagtgg
ctgcaggataagctgggccaaccggtcttcatcgacaacgatgtccgggttaatttgtac
ggtgaaatggcgtttggggccggaagaggtcatcgaaacgttgtcttggtcaccattggt
accggacttggcgcagctgttctgattaacggccaagtgttatatggtgcttccaatagt
gtcggtgagatcggccacatgaacatgtaccgccacggtcggccgtgcgcttgtgggagt
accggctgtttgggacggtatgtttccgctcgcgggattgtcaaaaccatgcaggaaaaa
ctggctgacggccaaaccagcttagtgggtgaatggatgtcacaagggcaggaactgacc
accaaattgatctcgaaagcggtagcaaaaggagatccaaccgctgttgaagtctttaaa
gaaactggcgagttgctgggatttgggttgggcaacgtgattaatttgtttaatccggaa
acgttaatcctgggtggcggcgtctcggctgccggagagccgttgttcaaatatacccgc
gaaaccttggcgcatcattccctgccggttgcccgtgaagcctgcaagctggagacggcg
cagctgggcgatgaagcaggaatggtcggtgcggcggtgtatgcggggcaaaaagtcaga
gcgtga

DBGET integrated database retrieval system