KEGG   Lactobacillus buchneri CD034: LBUCD034_2202Help
Entry
LBUCD034_2202     CDS       T02244                                 

Gene name
aep1
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBUCD034_2202 (aep1)
   00052 Galactose metabolism
    LBUCD034_2202 (aep1)
Enzymes [BR:lbn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LBUCD034_2202 (aep1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2205122..2206138
Genome map
AA seq 338 aa AA seqDB search
MNTKKELFDKLDGQDIEKFTITNDHNVSVSAITFGATLEEFNVPGPDGKPTNILVSVPSS
EELMKNQYFCQAIGRTAGRITNGTFKIKGQEYHVDSNEGTTTLHGGPHGFNTQIWDGSFD
GDTIVFTKHIDSSEDSFPGNIDVKITFSLNNDNELTATYSAKSDADTLFNPTQHMYFNLS
EGDSINGQSLQINADKYLELNKDKTPTGKKVAVDDTPYDFRDNQNLKVGIADMKAEVGHS
YDEVFEINDHQDDEPVATLSDPESGRSVSISSKRNALVVFTPDDLTGTNYLRGKGGPYMA
IALEAQNLPDTPNHADFGDVILPAGEEKTYSIKYKVEF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaagaaagaattgttcgataagttagatggtcaagacattgaaaagttcacc
attaccaacgatcacaacgtttctgtttcagcaattacctttggggcaaccttggaagaa
ttcaacgttcccggacccgacggcaaaccaaccaatattttggtcagcgtgcccagcagt
gaagaattgatgaagaatcaatacttctgccaggcaatcggtcgaactgccggccgaatc
accaacggtactttcaagatcaagggtcaggaataccacgttgattcaaacgaaggcacc
acgactttgcatggtggcccccacgggttcaacacccaaatctgggacggatcatttgat
ggtgacaccatcgtcttcaccaagcatatcgactcttctgaggattcattccccggcaac
atcgacgtcaagattactttctcactcaataacgataatgaattaaccgctacttacagt
gccaagagtgacgccgacactttgttcaacccaacccagcatatgtacttcaacttgagt
gaaggtgacagcattaacggccaatcacttcaaatcaacgccgacaagtaccttgaattg
aacaaggacaagacaccaaccggtaagaaagtcgccgtggatgacaccccatacgacttc
cgcgataaccaaaacctcaaggtcggtatcgccgacatgaaggccgaagttggtcacagt
tatgatgaagtctttgaaatcaatgaccatcaagacgacgaaccggtcgcaaccttatcc
gatcccgaaagcggccgcagcgtttcgatcagttccaagcgaaatgcattggttgtcttc
acaccggatgatctaaccggcaccaactatctccgcggaaaaggcggcccatacatggca
attgctttggaagcccaaaacttgccagacacccctaaccacgcagacttcggtgatgtc
atattgccagctggtgaggaaaagacctacagcattaagtacaaggttgaattctag

DBGET integrated database retrieval system