KEGG   Lactobacillus buchneri CD034: LBUCD034_2312Help
Entry
LBUCD034_2312     CDS       T02244                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
lbn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lbn01100  Metabolic pathways
lbn01110  Biosynthesis of secondary metabolites
lbn01130  Biosynthesis of antibiotics
lbn01230  Biosynthesis of amino acids
Module
lbn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LBUCD034_2312 (trpC)
Enzymes [BR:lbn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LBUCD034_2312 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE QRPTase_C His_biosynth ThiG ComA PDZ Pantoate_transf NMO Response_reg
Motif
Other DBs
NCBI-ProteinID: AFS01282
UniProt: J9W6S5
Position
2341861..2342649
Genome map
AA seq 262 aa AA seqDB search
MILDDLVTATHKRLKKHEAQTPLTELKNEVAQMPASVKPDFLDVLNESGLHVIAEVKKAS
PSKGTIVTDFPYLQIAKSYDAAGADAISVLTEPDYFNGHLNYLKKISQSVSAPTLRKDFT
IDPYMIYEAKANGASIILLIVAIVDDQQLRAYRELAERLGMQAIVEAYTADEVTRALKSG
AKIIGINNRNLKDFQVDFENSLKLRAMIPEGIPVIAESGIQTQADVEALADAGFNGILMG
ETLMRANNKQQLIKEFKAATVK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgatttagtaaccgcaacccacaaacgtttaaaaaagcacgaagctcaa
acaccactcacagaattgaaaaatgaagtcgctcaaatgcctgccagtgtgaagcctgat
tttctggacgttttgaatgaatctggactccacgtgatcgccgaggtgaagaaagcctcc
ccatctaaaggaacgatcgtcactgatttcccgtatctccaaattgctaaaagttatgac
gcagcgggagcagatgccatttctgttctgacagaaccggattacttcaacggccacctc
aactacctgaagaaaattagccagtcagtctccgcaccaacgcttcgaaaggatttcacg
attgatccttacatgatttacgaagccaaagccaacggtgcctcgatcatccttctgatt
gttgccatcgtcgatgaccagcaattaagagcctaccgagaattggcagagcgcctgggc
atgcaggccattgtggaagcctacacggcagatgaagtcacccgggcattgaaatccggc
gccaagatcatcggcatcaataaccggaatctcaaagatttccaagtggattttgaaaac
agtttgaaattacgggcaatgattccagaaggcatccccgtgatcgccgaaagcggcatc
cagacccaagcagatgttgaagccctggccgatgccggcttcaacggcatcctgatgggt
gaaaccctcatgcgggccaacaacaagcaacaactgattaaagaattcaaagcagctacc
gtcaaataa

DBGET integrated database retrieval system