KEGG   Lactobacillus buchneri CD034: LBUCD034_2314Help
Entry
LBUCD034_2314     CDS       T02244                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBUCD034_2314 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBUCD034_2314 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LBUCD034_2314 (trpB)
Enzymes [BR:lbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LBUCD034_2314 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2343252..2344469
Genome map
AA seq 405 aa AA seqDB search
MKNLTEAQITKRPGIFADTYGGQYIPETLMTELEKVDKAFHTLKDDPDFQAELHDLLINY
ANRPSLLYYAKNMTEDLGGAKIYLKREDLNHTGAHKINNVIGQALLAKHLGKKRLIAETG
AGQHGVATATIAALFGMDCEIFMGKEDTDRQKLNVYRMELLGAKVHPVTTGSMVLKDAIN
ATLQEWASRSEDTFYVMGSAVGPYPFPEMVKYFQSVISKESKQQLKAKENTLPDMVVACV
GGGSNAIGSFADYIDDPSVKLVGVEAAGKGVNSDQTAATIERGSVGIFHGMKSLFLQNED
GQINPVYSISAGLDYPGVGPEHAALAKEGRAQYVGITDDEAVQAFEYIARQEGIVAAIES
CHAVAYVEKIAPTMSKDQIIVCTLSGRGDKDVASIAKYKGVDIDE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaactgaagctcaaataaccaaacgaccaggaattttcgccgatacatac
ggcggccaatacatccctgaaaccttaatgactgaattggaaaaagtcgataaagccttt
cacactttgaaagacgatcccgacttccaagccgaattacacgatttattaattaactat
gccaaccggccatcactgctctattatgccaagaacatgaccgaagacctcggcggcgcc
aaaatctacctcaagcgtgaggacctcaaccataccggtgcccataagatcaacaacgtt
atcggccaagcattactcgccaaacatttgggcaagaagcgtctgatcgctgaaaccggt
gccggccaacatggggttgccaccgcaaccatcgctgctttgttcgggatggactgtgaa
attttcatgggtaaagaagatactgaccgccaaaaattaaacgtctaccgaatggagttg
cttggtgcgaaggttcacccggtcaccactggctcgatggtcctcaaagatgccatcaac
gccacactccaggaatgggctagtcgttccgaagacaccttttacgtcatgggatcggct
gttggcccctacccatttccagaaatggttaaatatttccaaagcgtcatcagtaaagaa
tccaagcagcaacttaaagccaaagaaaacaccttgccagacatggttgtcgcttgtgtt
ggcggcggcagtaacgctatcggcagtttcgccgattatatcgacgacccaagcgtcaaa
ttagtcggcgtggaagctgccggtaaaggggttaacagtgatcagaccgcagccaccatt
gaacgcggctccgtcggcatcttccacggcatgaagtcattattcctgcaaaacgaagac
ggccagatcaacccagtgtattcaatttctgccggtttggattatcctggtgtcggtccg
gaacacgctgccctggctaaagaaggccgagcgcaatatgtcggcatcaccgatgatgaa
gctgtccaggcgtttgaatacatcgcccgacaagaaggcatcgttgccgcaattgaaagc
tgtcacgcagttgcttacgtcgaaaagattgccccaaccatgtctaaagatcagattatc
gtctgcaccctgtcaggacgcggcgacaaagacgttgccagcattgccaaatacaaagga
gtcgatattgatgagtaa

DBGET integrated database retrieval system