KEGG   Lactobacillus buchneri CD034: LBUCD034_2314Help
Entry
LBUCD034_2314     CDS       T02244                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lbn01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lbn00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lbn00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2343252..2344469
Genome map
AA seq 405 aa AA seqDB search
MKNLTEAQITKRPGIFADTYGGQYIPETLMTELEKVDKAFHTLKDDPDFQAELHDLLINY
ANRPSLLYYAKNMTEDLGGAKIYLKREDLNHTGAHKINNVIGQALLAKHLGKKRLIAETG
AGQHGVATATIAALFGMDCEIFMGKEDTDRQKLNVYRMELLGAKVHPVTTGSMVLKDAIN
ATLQEWASRSEDTFYVMGSAVGPYPFPEMVKYFQSVISKESKQQLKAKENTLPDMVVACV
GGGSNAIGSFADYIDDPSVKLVGVEAAGKGVNSDQTAATIERGSVGIFHGMKSLFLQNED
GQINPVYSISAGLDYPGVGPEHAALAKEGRAQYVGITDDEAVQAFEYIARQEGIVAAIES
CHAVAYVEKIAPTMSKDQIIVCTLSGRGDKDVASIAKYKGVDIDE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaactgaagctcaaataaccaaacgaccaggaattttcgccgatacatac
ggcggccaatacatccctgaaaccttaatgactgaattggaaaaagtcgataaagccttt
cacactttgaaagacgatcccgacttccaagccgaattacacgatttattaattaactat
gccaaccggccatcactgctctattatgccaagaacatgaccgaagacctcggcggcgcc
aaaatctacctcaagcgtgaggacctcaaccataccggtgcccataagatcaacaacgtt
atcggccaagcattactcgccaaacatttgggcaagaagcgtctgatcgctgaaaccggt
gccggccaacatggggttgccaccgcaaccatcgctgctttgttcgggatggactgtgaa
attttcatgggtaaagaagatactgaccgccaaaaattaaacgtctaccgaatggagttg
cttggtgcgaaggttcacccggtcaccactggctcgatggtcctcaaagatgccatcaac
gccacactccaggaatgggctagtcgttccgaagacaccttttacgtcatgggatcggct
gttggcccctacccatttccagaaatggttaaatatttccaaagcgtcatcagtaaagaa
tccaagcagcaacttaaagccaaagaaaacaccttgccagacatggttgtcgcttgtgtt
ggcggcggcagtaacgctatcggcagtttcgccgattatatcgacgacccaagcgtcaaa
ttagtcggcgtggaagctgccggtaaaggggttaacagtgatcagaccgcagccaccatt
gaacgcggctccgtcggcatcttccacggcatgaagtcattattcctgcaaaacgaagac
ggccagatcaacccagtgtattcaatttctgccggtttggattatcctggtgtcggtccg
gaacacgctgccctggctaaagaaggccgagcgcaatatgtcggcatcaccgatgatgaa
gctgtccaggcgtttgaatacatcgcccgacaagaaggcatcgttgccgcaattgaaagc
tgtcacgcagttgcttacgtcgaaaagattgccccaaccatgtctaaagatcagattatc
gtctgcaccctgtcaggacgcggcgacaaagacgttgccagcattgccaaatacaaagga
gtcgatattgatgagtaa

DBGET integrated database retrieval system