KEGG   Lactobacillus buchneri CD034: LBUCD034_2315Help
Entry
LBUCD034_2315     CDS       T02244                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
lbn00260  Glycine, serine and threonine metabolism
lbn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lbn01100  Metabolic pathways
lbn01110  Biosynthesis of secondary metabolites
lbn01130  Biosynthesis of antibiotics
lbn01230  Biosynthesis of amino acids
Module
lbn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBUCD034_2315 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LBUCD034_2315 (trpA)
Enzymes [BR:lbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LBUCD034_2315 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA Glyco_tran_WecB
Motif
Other DBs
NCBI-ProteinID: AFS01285
UniProt: J9W8X8
Position
2344462..2345259
Genome map
AA seq 265 aa AA seqDB search
MSNLSAIFKNHKAFIPFVVADDPDFDTTVANIVALAEGGADIVEVGIPFSDPIADGGVIQ
AADLRAFDAGVRTKTVFEIVEAARKQTDVPIVFLTYLNIVFKYGYDAFCKKCQALGVSGL
VIPDMPYESRDDIVPTADKYGIDIIPLIAPTSGHRVEKIAKAASGFIYVVSSLGITGERN
EFFNGLKDLVAEIKSYTDVPTAIGFGVHTPEQAKTMAEIADGVIIGSAIVDIVAKQKQNA
PEAVKEFTHSIRSAVDQAETKEASV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttatccgccattttcaaaaatcataaagcatttattccgtttgtcgtggct
gacgacccggattttgataccacagttgccaatatcgtcgctttggccgaaggcggtgcc
gacatcgttgaagtcggaattcccttctccgacccaatcgctgacggcggcgtgattcag
gcggccgacctgcgggcatttgacgccggcgtccgtaccaagacggtctttgaaatcgtt
gaggctgcccgtaaacaaaccgatgtgccgattgtttttctcacttatttaaacatcgtc
ttcaagtatggttacgatgcattctgtaaaaagtgtcaggccctcggcgtttctggcttg
gtcattcccgacatgccctatgaaagccgcgatgacatcgttccaaccgctgataaatat
ggcatcgacatcatcccgctgattgcgccgacttccggccaccgagttgaaaagattgcc
aaggcagcgtctggattcatctacgtggtttcctcactgggcattaccggtgaacgaaat
gaattcttcaatggtttgaaggatctggttgccgaaatcaaatcgtatactgacgttcct
acggcaatcggctttggcgtccacacgccggagcaggccaagacgatggcggaaatcgcg
gacggcgtgattatcggtagtgcgattgttgacatcgttgccaagcagaaacaaaatgcc
cctgaagcagtaaaagaatttactcattcgattcgttcggctgttgatcaagctgaaact
aaagaagccagcgtctaa

DBGET integrated database retrieval system