KEGG   Lactobacillus buchneri CD034: LBUCD034_2315Help
Entry
LBUCD034_2315     CDS       T02244                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBUCD034_2315 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBUCD034_2315 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LBUCD034_2315 (trpA)
Enzymes [BR:lbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LBUCD034_2315 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2344462..2345259
Genome map
AA seq 265 aa AA seqDB search
MSNLSAIFKNHKAFIPFVVADDPDFDTTVANIVALAEGGADIVEVGIPFSDPIADGGVIQ
AADLRAFDAGVRTKTVFEIVEAARKQTDVPIVFLTYLNIVFKYGYDAFCKKCQALGVSGL
VIPDMPYESRDDIVPTADKYGIDIIPLIAPTSGHRVEKIAKAASGFIYVVSSLGITGERN
EFFNGLKDLVAEIKSYTDVPTAIGFGVHTPEQAKTMAEIADGVIIGSAIVDIVAKQKQNA
PEAVKEFTHSIRSAVDQAETKEASV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttatccgccattttcaaaaatcataaagcatttattccgtttgtcgtggct
gacgacccggattttgataccacagttgccaatatcgtcgctttggccgaaggcggtgcc
gacatcgttgaagtcggaattcccttctccgacccaatcgctgacggcggcgtgattcag
gcggccgacctgcgggcatttgacgccggcgtccgtaccaagacggtctttgaaatcgtt
gaggctgcccgtaaacaaaccgatgtgccgattgtttttctcacttatttaaacatcgtc
ttcaagtatggttacgatgcattctgtaaaaagtgtcaggccctcggcgtttctggcttg
gtcattcccgacatgccctatgaaagccgcgatgacatcgttccaaccgctgataaatat
ggcatcgacatcatcccgctgattgcgccgacttccggccaccgagttgaaaagattgcc
aaggcagcgtctggattcatctacgtggtttcctcactgggcattaccggtgaacgaaat
gaattcttcaatggtttgaaggatctggttgccgaaatcaaatcgtatactgacgttcct
acggcaatcggctttggcgtccacacgccggagcaggccaagacgatggcggaaatcgcg
gacggcgtgattatcggtagtgcgattgttgacatcgttgccaagcagaaacaaaatgcc
cctgaagcagtaaaagaatttactcattcgattcgttcggctgttgatcaagctgaaact
aaagaagccagcgtctaa

DBGET integrated database retrieval system