KEGG   Lactobacillus buchneri CD034: LBUCD034_2407Help
Entry
LBUCD034_2407     CDS       T02244                                 

Gene name
thrC
Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBUCD034_2407 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBUCD034_2407 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LBUCD034_2407 (thrC)
Enzymes [BR:lbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LBUCD034_2407 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2433716..2435221
Genome map
AA seq 501 aa AA seqDB search
MNKYYTSTRNGSVQISAKQAIKKGFADDKGLFVYPDLEKLQVNFEKLLKLNYQDIARAVL
TILLPDFSADEIDESVHAAYQSSFDTQKITPVVPVDNFHILELFHGPTSAFKDVGLQLLP
QLMKHVLVDNNKVMILTATSGDTGKAALEGFKGLDNMGIIVFYPDGGVSKIQKLQMITTG
GNNTKVAAIEGNFDDAQTNVKRIFNDQALKKSLGDDVSLSSANSINIGRLIPQVVYYFDS
YKQLVNDGSIEVGQKVNFTVPTGNFGDVLAGYYAKMLGLPVNKFVVACNENNVLANFFNH
GVYDRNRPFFQTVAPSMDIQISSNFERLLYYKSGQDTEYVKQLMDDLEDSGKYEVSKEVL
ANIQQDFYCGYSTDDDIERSIAEVYEQNGYLMDPHTAAGYKVMRDYQKLDPETPMILLST
ASPYKFVNAVANAVLPETSADVQQVMRDLHDATNAPIPDNLRKVWDLPVRHESVIQKDQM
TDYVKQKVEEVFYDQDQGTRN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatattatacgagtaccagaaacggttcagttcaaatttcagccaagcaggcc
atcaagaagggcttcgctgatgacaagggtctcttcgtttatcccgacttggaaaagctc
caagtaaacttcgaaaaattactaaaattaaattatcaagatattgccagagcagtgctg
acgattttattgccggacttctctgccgatgaaattgacgaaagtgtccatgcggcttat
cagtcgagttttgacacgcaaaaaattacgccggttgttcccgttgataatttccatatc
ctggaactcttccatggaccaaccagtgcttttaaagatgtcggcttgcagctattgcct
caattaatgaagcacgtattggtcgacaataataaggtaatgatcctgacggctaccagt
ggcgacactggcaaggctgctttggaaggctttaagggcttggataacatgggcattatt
gtcttctatccagacggtggtgtcagcaagattcaaaagctgcagatgatcacaaccggt
gggaacaacaccaaggtcgcagcaattgaaggaaattttgatgacgctcagacaaacgtt
aagcgaattttcaatgaccaagctctaaagaaatcccttggtgacgatgtcagcttatca
agtgccaattcgatcaatatcggccgactgattccccaagtcgtttattattttgattcc
tataaacagttggtgaacgatggctcgattgaagtcggccaaaaggtcaacttcaccgtt
ccaaccggtaactttggtgacgtcctggctgggtactacgccaaaatgctgggccttccc
gtgaacaaatttgtcgtcgcatgtaatgaaaataacgtgttggccaacttctttaaccac
ggggtctacgatcgcaaccggccatttttccagaccgtcgccccaagtatggacatccaa
atttccagcaactttgaacgcctcctctactataagagtggtcaggacaccgaatacgtt
aaacaattgatggatgacttggaagacagcggtaagtatgaagtttccaaggaagttctg
gcaaatatccagcaggatttctactgcggctatagtaccgatgacgatattgaacggtcg
attgccgaagtctacgaacaaaacggctacttgatggatccccataccgcggccggctac
aaagtcatgcgcgactatcaaaagctcgatcctgaaacaccgatgatcctgttaagtacc
gccagtccctataaatttgttaatgcggttgccaacgctgttctgccagaaacttcagcg
gatgtccaacaagtgatgcgggacttacatgacgcaaccaacgcaccgattccagataac
ctgagaaaagtctgggatctgcccgttcgtcacgaaagtgtcatccaaaaagatcaaatg
accgattacgtcaaacaaaaagtcgaggaggtattttatgatcaagatcaaggtacccgc
aactag

DBGET integrated database retrieval system