KEGG   Lactobacillus buchneri CD034: LBUCD034_2407Help
Entry
LBUCD034_2407     CDS       T02244                                 

Gene name
thrC
Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBUCD034_2407 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBUCD034_2407 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LBUCD034_2407 (thrC)
Enzymes [BR:lbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LBUCD034_2407 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2433716..2435221
Genome map
AA seq 501 aa AA seqDB search
MNKYYTSTRNGSVQISAKQAIKKGFADDKGLFVYPDLEKLQVNFEKLLKLNYQDIARAVL
TILLPDFSADEIDESVHAAYQSSFDTQKITPVVPVDNFHILELFHGPTSAFKDVGLQLLP
QLMKHVLVDNNKVMILTATSGDTGKAALEGFKGLDNMGIIVFYPDGGVSKIQKLQMITTG
GNNTKVAAIEGNFDDAQTNVKRIFNDQALKKSLGDDVSLSSANSINIGRLIPQVVYYFDS
YKQLVNDGSIEVGQKVNFTVPTGNFGDVLAGYYAKMLGLPVNKFVVACNENNVLANFFNH
GVYDRNRPFFQTVAPSMDIQISSNFERLLYYKSGQDTEYVKQLMDDLEDSGKYEVSKEVL
ANIQQDFYCGYSTDDDIERSIAEVYEQNGYLMDPHTAAGYKVMRDYQKLDPETPMILLST
ASPYKFVNAVANAVLPETSADVQQVMRDLHDATNAPIPDNLRKVWDLPVRHESVIQKDQM
TDYVKQKVEEVFYDQDQGTRN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatattatacgagtaccagaaacggttcagttcaaatttcagccaagcaggcc
atcaagaagggcttcgctgatgacaagggtctcttcgtttatcccgacttggaaaagctc
caagtaaacttcgaaaaattactaaaattaaattatcaagatattgccagagcagtgctg
acgattttattgccggacttctctgccgatgaaattgacgaaagtgtccatgcggcttat
cagtcgagttttgacacgcaaaaaattacgccggttgttcccgttgataatttccatatc
ctggaactcttccatggaccaaccagtgcttttaaagatgtcggcttgcagctattgcct
caattaatgaagcacgtattggtcgacaataataaggtaatgatcctgacggctaccagt
ggcgacactggcaaggctgctttggaaggctttaagggcttggataacatgggcattatt
gtcttctatccagacggtggtgtcagcaagattcaaaagctgcagatgatcacaaccggt
gggaacaacaccaaggtcgcagcaattgaaggaaattttgatgacgctcagacaaacgtt
aagcgaattttcaatgaccaagctctaaagaaatcccttggtgacgatgtcagcttatca
agtgccaattcgatcaatatcggccgactgattccccaagtcgtttattattttgattcc
tataaacagttggtgaacgatggctcgattgaagtcggccaaaaggtcaacttcaccgtt
ccaaccggtaactttggtgacgtcctggctgggtactacgccaaaatgctgggccttccc
gtgaacaaatttgtcgtcgcatgtaatgaaaataacgtgttggccaacttctttaaccac
ggggtctacgatcgcaaccggccatttttccagaccgtcgccccaagtatggacatccaa
atttccagcaactttgaacgcctcctctactataagagtggtcaggacaccgaatacgtt
aaacaattgatggatgacttggaagacagcggtaagtatgaagtttccaaggaagttctg
gcaaatatccagcaggatttctactgcggctatagtaccgatgacgatattgaacggtcg
attgccgaagtctacgaacaaaacggctacttgatggatccccataccgcggccggctac
aaagtcatgcgcgactatcaaaagctcgatcctgaaacaccgatgatcctgttaagtacc
gccagtccctataaatttgttaatgcggttgccaacgctgttctgccagaaacttcagcg
gatgtccaacaagtgatgcgggacttacatgacgcaaccaacgcaccgattccagataac
ctgagaaaagtctgggatctgcccgttcgtcacgaaagtgtcatccaaaaagatcaaatg
accgattacgtcaaacaaaaagtcgaggaggtattttatgatcaagatcaaggtacccgc
aactag

DBGET integrated database retrieval system