KEGG   Lactobacillus brevis ATCC 367: LVIS_0080Help
Entry
LVIS_0080         CDS       T00406                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lbr00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
82989..84500
Genome map
AA seq 503 aa AA seqDB search
MSENSTVKKNVRVRYAPSPTGFLHIGNAQSALFNYLFARHYHGTMVLRIEDTDVKRNVPH
GEDSQIDNLHWLGIDWDEGPDKPNPKYAPYHQTERQDLYHRYITQLLDQGLAYKDYATED
ELTTMRDQQRAAGEAPHYDGRWYGRSVADQQAAEARGLKPSIRLHLPANHEYAWDDIIKG
HVAFNSDNMGGDFIIEKSNGMPTYNFAVVIDDYLMDITDVLRGDDHIANTPKQIAVYEAL
GLKHPNFGHITLIYNPKTRKKLSKRDKETLQFISQYKNQGYLSEAIFNFIAFLGWSPEGE
DELFSREELIERYDPARMSKSPAYFDQSKLDWINAAYIKRLDLDDMTDRVLELVDEGQTD
VARQVKALQLPDLRTLTSQVCKIYQTEIHQLSEIMDKVLFYVTILQEPLDYDQLRQFDRT
ATLAVLTAFRKHVQALPVDVATPDFKKMIQTVSQETGVTGRNLYFPLNVAFTGDHSAPQI
DEVLRLFANSTIIELLTKAIAHV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaattcgacagtgaaaaagaacgtgagagtgaggtatgcaccgagtccgaca
ggtttcttgcacattggcaatgcccaatcggccttattcaactacctgtttgcgcggcac
tatcacggaaccatggttttacgaattgaagatacggatgttaaacgtaacgtcccccat
ggtgaagatagccaaattgataatcttcattggttgggaattgattgggatgaaggccct
gataagcccaatcccaagtacgcaccgtatcatcaaacagaacggcaagacctctatcac
cgttacattacacagctgcttgaccaagggttagcttacaaagactacgcaacggaagat
gaattaaccactatgcgggaccaacaacgggccgcgggtgaagcaccgcactacgatggt
cggtggtatggtcggtcagtagccgatcaacaggcggcggaggcccgcgggttaaaacct
agtattcgcctccatttgccggcgaaccatgaatacgcttgggatgacattattaaaggt
catgtggcttttaactccgacaatatgggcggtgatttcattattgagaagagtaatggg
atgcccacttataattttgccgtggtcattgatgattacctgatggatatcacagatgtc
ttacggggagatgaccacattgccaatacgccaaagcaaattgcggtgtatgaagcctta
ggcttgaagcacccgaactttgggcacattacgttaatttataatcctaaaacgcgtaaa
aaattgagtaagcgggataaggaaacattacagtttattagtcaatataagaaccaaggc
tatttaagcgaagcaatcttcaactttattgcctttttaggatggtcaccagaaggcgag
gacgaacttttctcacgagaagagctcattgaacgttatgatccagccagaatgtccaaa
tcgccagcctactttgatcaaagcaaactggattggatcaacgcggcttacattaagcgc
ttagacctcgatgatatgacggatcgggtactggaattggtcgacgagggacaaacggat
gttgctaggcaggtaaaggcattgcaattacctgacttacggacattaacgtctcaagtt
tgcaaaatctatcaaacggaaatccaccagttgagtgagattatggataaggttttgttt
tatgtgacgattttgcaggaaccactggattatgatcaattacggcaattcgatcggacg
gcaaccctagcggtactaacggcctttcgaaaacatgttcaggcactgcctgtagatgtc
gcaacaccggactttaaaaagatgattcaaaccgtgagtcaggagacgggcgtcacaggt
cgtaacctatatttcccactgaacgtggctttcacgggcgatcattcggcaccacaaatt
gatgaggttctccggttgtttgccaacagcaccattattgaactcttaaccaaagccatt
gcccatgtttaa

DBGET integrated database retrieval system