KEGG   Lactobacillus brevis ATCC 367: LVIS_0119Help
Entry
LVIS_0119         CDS       T00406                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LVIS_0119
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LVIS_0119
   00620 Pyruvate metabolism
    LVIS_0119
   00650 Butanoate metabolism
    LVIS_0119
  Lipid metabolism
   00071 Fatty acid degradation
    LVIS_0119
  Amino acid metabolism
   00350 Tyrosine metabolism
    LVIS_0119
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LVIS_0119
   00626 Naphthalene degradation
    LVIS_0119
Enzymes [BR:lbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LVIS_0119
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LVIS_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
126168..128786
Genome map
AA seq 872 aa AA seqDB search
MLKDVKENSKSKSKESAETVDQMIDRLTAKAHDALCAMDDFTQEQVDHIVHQMSIAALDQ
HMVLAKAAFKETGRGVMEDKAVKNMYASEEIWHSIKHDKTVGIIKDDHERQLITVAEPLG
ILAGVTPVTNPTSTTIFKSLIAVKTRNPIIFAFHPQAQQSSVMAAKVVRDAAIAAGAPEG
VIQWIETPSLEATTALMNHPMVASVLATGGPGMVKAAYSTGKPALGVGPGNGPAYIEKTA
NIKRAVYDIVLSKTFDNGMVCASENSAVIDHEIYDDVKKEMQDRGVFFIKKSDEKALADT
MFKPEGGVKGPIPGMSAQKIADLAGIKVPAGTKVLAAEITGVGPKFPLSQEKLCPMISVY
KATSQENAFKLCDDLLHFGGLGHTASLHTMDDALATKFGIAMKASRVLINTPSAIGGIGN
LYNEMVPSLTLGTGSWGKNSVSHNVSSFDLLNIKTIAKRRNNMQWIKLPRVYFEKTSVRY
LDDMPGIKRVFLVTDPAMVELGYIDTVLNELKRQPNGIEYSLFSDVEPDPTTDTVNRGVA
QMRMFKPDTIVALGGGSAMDAAKNMWLFYEDPEASFFGAKQKFLDIRKRAYKFNKPHKAQ
FVAIPTTSGTGSEVTPFAVITDSKTHVKYPLADYALTPDVAIVDSQFIETVPKKTVAYSG
LDVLTHAIESYVSNMASDYTRPWSLQAIKLVMDNLTNSYNGDITAREEMHNASTLAGMAF
ANAFLGIDHSIAHKLGGEFGLPHGLAIAITLPHVIRYNFKEPTKLSMWPKYDHFKADEDY
AQIARYLGLPGTTNEELKEALVKKIIDLAHSVDVTLSLKANGVDKAHFDQAVDKLAELAF
EDQCTTANPREPLVSELKQIMLDEYDGKNVEK
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagacgtgaaagagaattcaaaatcaaaatcaaaagaaagcgctgaaaccgtt
gaccagatgatcgaccggttgacggccaaggcccatgacgccctgtgtgccatggatgac
tttactcaagaacaagtcgatcacatcgttcaccagatgtcgattgcagctttagatcag
catatggttttagccaaggccgcttttaaagaaactggtcgtggagtgatggaagacaag
gccgtaaagaatatgtatgcgagtgaagaaatttggcactctatcaagcatgacaaaaca
gttggcattattaaggatgaccatgaacggcaattgatcacagttgctgaaccactggga
attctggccggggtaacgcctgtcacgaacccgacgtcaaccactatctttaagtccctg
attgcggttaagacgcggaaccccatcatctttgctttccatccacaagcccaacaatct
tcggttatggcggccaaagttgttcgtgatgcggccatcgctgctggtgcaccagaaggg
gttattcaatggattgaaacgccaagcttggaagcaacgacagccttaatgaatcaccca
atggttgccagtgtcttagcgaccggtggtcctggtatggtgaaggccgcttactcaact
gggaagccagccttaggggtgggtcctggtaacggtccagcttacattgaaaagacggcg
aatatcaaacgggccgtttatgacattgtcttatcgaagacctttgataacgggatggtt
tgtgcctccgaaaacagtgcggtcattgaccatgaaatctatgatgacgttaaaaaagaa
atgcaagaccgtggcgttttcttcattaagaagagcgacgaaaaggccctagctgacact
atgttcaaaccagagggtggcgttaaaggcccaattccagggatgtcagcacaaaagatc
gctgatttggctgggatcaaggttcctgctggtacgaaggtgttagctgctgagattacc
ggagtcggaccaaagttcccattgtctcaagaaaaactatgtccaatgatttcagtttac
aaggcaacgagtcaggaaaatgccttcaagctttgtgatgacttgctccacttcggtggt
ctcggtcacacggcatctcttcacacaatggatgatgctttggcaacgaagtttgggatt
gcgatgaaggctagtcgagtattgatcaataccccatctgctatcggtggtatcgggaac
ctttacaatgaaatggtgccatcattgaccttaggaacgggatcatggggtaaaaactct
gtttcccataacgtttcttcctttgatttactgaacatcaaaacgattgcaaagcggcga
aataatatgcagtggattaaattacctcgggtttattttgaaaagacatcagttcgctac
ctcgacgacatgccaggcatcaaacgggtattcttagttactgacccagccatggttgaa
ctcggttacatcgacaccgtgctgaatgaattgaagcgtcaaccaaacggcattgaatac
tccttgttctctgacgtggaacctgatccaacgacggatacggttaaccgtggggttgct
caaatgcggatgttcaagccagatacaattgtggctttaggtggaggttcagcaatggat
gctgccaagaatatgtggttattctacgaagatccagaagccagcttctttggcgctaag
cagaaattcttggatatccggaaacgggcttacaagtttaacaagccgcacaaggcccaa
tttgttgccattccaaccacttctggaacgggttcagaagtcacaccgtttgccgtgatt
acggattctaagactcacgtgaagtacccactggctgactatgccttaacgccagacgtt
gcgattgtggattcccaatttatcgaaacggtccctaagaagacggtggcttactctggg
ttagacgttttaacccatgccattgaatcttacgtgtcaaacatggcttctgattacacc
cggccatggtcattacaagcgattaaattagtgatggataacctgactaattcctacaac
ggtgacattacagcgcgcgaagagatgcacaatgcttcaacgctagctgggatggcgttt
gccaacgccttcttggggattgatcactcgattgcccacaagttgggtggcgaatttggg
ttacctcatggattggctattgccattaccttgccacacgttatccggtataacttcaag
gaaccaacgaagttatccatgtggccaaagtatgatcacttcaaggctgatgaagactat
gctcaaatcgcacgttacttgggtctgccaggaacgactaacgaagagctcaaggaagct
cttgtcaagaagatcattgatctggcccattccgttgatgtgaccttaagtctgaaggcc
aacggtgttgacaaagctcactttgaccaagcagtggacaagctagctgagttagccttt
gaggatcaatgtacaacggctaatccacgcgaaccactcgtatctgaattaaagcaaatt
atgcttgatgaatacgatggtaagaacgttgaaaaataa

DBGET integrated database retrieval system